254576

Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) phd-doc/Doc-Phd
Location 84752..85353 Replicon plasmid unnamed1
Accession NZ_CP102948
Organism Escherichia coli strain SCAID WND1-2022 (119)

Toxin (Protein)


Gene name doc Uniprot ID V0AJ64
Locus tag NW339_RS25135 Protein ID WP_001216034.1
Coordinates 84752..85132 (-) Length 127 a.a.

Antitoxin (Protein)


Gene name phd Uniprot ID U9YQH9
Locus tag NW339_RS25140 Protein ID WP_001190712.1
Coordinates 85132..85353 (-) Length 74 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NW339_RS25100 (79803) 79803..80735 - 933 WP_000081352.1 homocysteine S-methyltransferase -
NW339_RS25105 (80722) 80722..82125 - 1404 WP_001373486.1 S-methylmethionine permease -
NW339_RS25110 (82369) 82369..83349 + 981 WP_000019407.1 IS5-like element IS5 family transposase -
NW339_RS25115 (83559) 83559..83909 + 351 WP_233291431.1 type I deoxyribonuclease HsdR -
NW339_RS25120 (83844) 83844..84257 - 414 Protein_100 integrase core domain-containing protein -
NW339_RS25125 (84262) 84262..84540 - 279 Protein_101 pdcB -
NW339_RS25130 (84568) 84568..84747 - 180 WP_001513661.1 hypothetical protein -
NW339_RS25135 (84752) 84752..85132 - 381 WP_001216034.1 type II toxin-antitoxin system death-on-curing family toxin Toxin
NW339_RS25140 (85132) 85132..85353 - 222 WP_001190712.1 type II toxin-antitoxin system Phd/YefM family antitoxin Antitoxin
NW339_RS25145 (85536) 85536..86792 + 1257 Protein_105 type I restriction-modification system subunit M -
NW339_RS25150 (86844) 86844..87541 + 698 WP_223216377.1 IS1-like element IS1A family transposase -
NW339_RS25155 (87678) 87678..88571 - 894 WP_001553853.1 S-4TM family putative pore-forming effector -
NW339_RS25160 (88614) 88614..89609 - 996 WP_000246636.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Non-Mobilizable plasmid blaCTX-M-27 senB 1..105437 105437
- inside IScluster/Tn - - 78846..87541 8695


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Death on curing protein

(2-123)

Antitoxin

Type II toxin-antitoxin system, antitoxin Phd/YefM

(1-51)


Sequences

Toxin        


Download         Length: 127 a.a.        Molecular weight: 13615.32 Da        Isoelectric Point: 5.1514

>T254576 WP_001216034.1 NZ_CP102948:c85132-84752 [Escherichia coli]
MRHISPEELIALHDANINRYGGLPGMSDPGRAEAIIGRVQARVAYEEITDLFEVSATYLVATARGHIFNDANKRTALNSA
LLFLRRNGVQVFDSPELADLTVGAATGEISVSSVADTLRRLYGSAE

Download         Length: 381 bp

Antitoxin


Download         Length: 74 a.a.        Molecular weight: 8133.10 Da        Isoelectric Point: 4.7708

>AT254576 WP_001190712.1 NZ_CP102948:c85353-85132 [Escherichia coli]
MQSINFRTARGNLSEVLNNVEAGEEVEITRRGREPAVIVSKATFEAYKKAALDAEFASLFDTLDSTNKELVNR

Download         Length: 222 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB V0AJ64

Antitoxin

Source ID Structure
AlphaFold DB A0A829CJB6

References