Detailed information of TA system
Overview
TA module
Type | IV | Classification (family/domain) | yeeUV (cbtA-cbeA)/CbtA-CbeA |
Location | 4457031..4457865 | Replicon | chromosome |
Accession | NZ_CP102947 | ||
Organism | Escherichia coli strain SCAID WND1-2022 (119) |
Toxin (Protein)
Gene name | yeeV | Uniprot ID | - |
Locus tag | NW339_RS22020 | Protein ID | WP_258390121.1 |
Coordinates | 4457488..4457865 (+) | Length | 126 a.a. |
Antitoxin (Protein)
Gene name | yeeU | Uniprot ID | - |
Locus tag | NW339_RS22015 | Protein ID | WP_258390120.1 |
Coordinates | 4457031..4457399 (+) | Length | 123 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NW339_RS21975 (4452158) | 4452158..4453042 | + | 885 | WP_258390115.1 | YfjP family GTPase | - |
NW339_RS21980 (4453161) | 4453161..4453838 | + | 678 | WP_001097364.1 | hypothetical protein | - |
NW339_RS21985 (4453844) | 4453844..4454077 | + | 234 | WP_258390116.1 | DUF905 domain-containing protein | - |
NW339_RS21990 (4454167) | 4454167..4454984 | + | 818 | Protein_4311 | DUF945 domain-containing protein | - |
NW339_RS21995 (4455075) | 4455075..4455560 | + | 486 | WP_258390117.1 | antirestriction protein | - |
NW339_RS22000 (4455576) | 4455576..4456052 | + | 477 | WP_258390118.1 | RadC family protein | - |
NW339_RS22005 (4456115) | 4456115..4456336 | + | 222 | WP_000692323.1 | DUF987 domain-containing protein | - |
NW339_RS22010 (4456349) | 4456349..4456981 | + | 633 | WP_258390119.1 | antitoxin of toxin-antitoxin stability system | - |
NW339_RS22015 (4457031) | 4457031..4457399 | + | 369 | WP_258390120.1 | type IV toxin-antitoxin system YeeU family antitoxin | Antitoxin |
NW339_RS22020 (4457488) | 4457488..4457865 | + | 378 | WP_258390121.1 | type IV toxin-antitoxin system cytoskeleton-binding toxin CbtA | Toxin |
NW339_RS22025 (4457862) | 4457862..4458350 | + | 489 | WP_258390122.1 | DUF5983 family protein | - |
NW339_RS22030 (4458362) | 4458362..4458559 | + | 198 | WP_000839249.1 | DUF957 domain-containing protein | - |
NW339_RS22035 (4458656) | 4458656..4459501 | + | 846 | WP_258390123.1 | DUF4942 domain-containing protein | - |
NW339_RS22040 (4459570) | 4459570..4459965 | + | 396 | WP_111986816.1 | DUF6088 family protein | - |
NW339_RS22045 (4459958) | 4459958..4460905 | + | 948 | WP_258390124.1 | nucleotidyl transferase AbiEii/AbiGii toxin family protein | - |
NW339_RS22050 (4461309) | 4461309..4461468 | + | 160 | Protein_4323 | integrase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 126 a.a. Molecular weight: 14003.07 Da Isoelectric Point: 7.2142
>T254568 WP_258390121.1 NZ_CP102947:4457488-4457865 [Escherichia coli]
MKTLPVLPGQVASSRPSPVEIWQILLSRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SACTCSQLINNIDILRARRATGLMTRDNYRTVNNITLGKHPEAKQ
MKTLPVLPGQVASSRPSPVEIWQILLSRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SACTCSQLINNIDILRARRATGLMTRDNYRTVNNITLGKHPEAKQ
Download Length: 378 bp
Antitoxin
Download Length: 123 a.a. Molecular weight: 13795.62 Da Isoelectric Point: 6.0666
>AT254568 WP_258390120.1 NZ_CP102947:4457031-4457399 [Escherichia coli]
VSDKLHETTHPDDNNDRPWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGRFRDADAYPLDQAFPLLMKQLELMLTSG
ELNPHRQNTVTLYARGLTCEADTLGSCGYIYLAVYPTPEMKN
VSDKLHETTHPDDNNDRPWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGRFRDADAYPLDQAFPLLMKQLELMLTSG
ELNPHRQNTVTLYARGLTCEADTLGSCGYIYLAVYPTPEMKN
Download Length: 369 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|