254555

Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type IV Classification (family/domain) yeeUV (cbtA-cbeA)/CbtA-CbeA
Location 1921728..1922559 Replicon chromosome
Accession NZ_CP102947
Organism Escherichia coli strain SCAID WND1-2022 (119)

Toxin (Protein)


Gene name yeeV Uniprot ID A0A066T988
Locus tag NW339_RS09150 Protein ID WP_000854815.1
Coordinates 1921728..1922102 (-) Length 125 a.a.

Antitoxin (Protein)


Gene name yeeU Uniprot ID A0A061Y7A8
Locus tag NW339_RS09155 Protein ID WP_001280918.1
Coordinates 1922191..1922559 (-) Length 123 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NW339_RS09110 (1917124) 1917124..1918290 + 1167 WP_001296209.1 serine-type D-Ala-D-Ala carboxypeptidase DacD -
NW339_RS09115 (1918409) 1918409..1918882 + 474 WP_001105368.1 DNA gyrase inhibitor SbmC -
NW339_RS09120 (1919080) 1919080..1920138 + 1059 WP_001200889.1 FUSC family protein -
NW339_RS09125 (1920310) 1920310..1920639 + 330 WP_000450409.1 DUF496 family protein -
NW339_RS09130 (1920740) 1920740..1921063 - 324 WP_225469267.1 EutP/PduV family microcompartment system protein -
NW339_RS09135 (1921042) 1921042..1921122 + 81 WP_023441679.1 hypothetical protein -
NW339_RS09140 (1921411) 1921411..1921491 - 81 Protein_1790 hypothetical protein -
NW339_RS09145 (1921537) 1921537..1921731 - 195 WP_000988600.1 DUF5983 family protein -
NW339_RS09150 (1921728) 1921728..1922102 - 375 WP_000854815.1 type IV toxin-antitoxin system cytoskeleton-binding toxin CbtA Toxin
NW339_RS09155 (1922191) 1922191..1922559 - 369 WP_001280918.1 type IV toxin-antitoxin system YeeU family antitoxin Antitoxin
NW339_RS09160 (1922575) 1922575..1923219 - 645 WP_000086752.1 hypothetical protein -
NW339_RS09165 (1923238) 1923238..1923459 - 222 WP_000692345.1 DUF987 domain-containing protein -
NW339_RS09170 (1923522) 1923522..1923998 - 477 WP_001186200.1 RadC family protein -
NW339_RS09175 (1924014) 1924014..1924487 - 474 WP_001542276.1 antirestriction protein -
NW339_RS09180 (1924581) 1924581..1924826 - 246 WP_001164966.1 hypothetical protein -
NW339_RS09185 (1924826) 1924826..1925644 - 819 WP_001542275.1 DUF932 domain-containing protein -
NW339_RS09190 (1925865) 1925865..1926275 - 411 WP_000846703.1 hypothetical protein -
NW339_RS09195 (1926291) 1926291..1926641 - 351 Protein_1801 hypothetical protein -
NW339_RS09200 (1926724) 1926724..1927470 - 747 WP_001016257.1 IS21-like element ISEc12 family helper ATPase IstB -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

CbtA toxin of type IV toxin-antitoxin system

(1-112)

Antitoxin

Antitoxin CbeA

(19-117)


Sequences

Toxin        


Download         Length: 125 a.a.        Molecular weight: 13829.83 Da        Isoelectric Point: 7.1326

>T254555 WP_000854815.1 NZ_CP102947:c1922102-1921728 [Escherichia coli]
MKTLPVLPGQAASSRPSPVEIWQILLSRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SACTRSQLINSIDILRARRATGLMTSDNYRTVNNITLGKYPEAK

Download         Length: 375 bp

Antitoxin


Download         Length: 123 a.a.        Molecular weight: 13811.70 Da        Isoelectric Point: 6.4767

>AT254555 WP_001280918.1 NZ_CP102947:c1922559-1922191 [Escherichia coli]
VSDKLHETNYPDDHNDRLWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGLFSDADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKGLTCKADTLSSCGYVYLAVYPTPEMKN

Download         Length: 369 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A066T988

Antitoxin

Source ID Structure
AlphaFold DB A0A061Y7A8

References