Detailed information of TA system
Overview
TA module
Type | IV | Classification (family/domain) | yeeUV (cbtA-cbeA)/CbtA-CbeA |
Location | 1921728..1922559 | Replicon | chromosome |
Accession | NZ_CP102947 | ||
Organism | Escherichia coli strain SCAID WND1-2022 (119) |
Toxin (Protein)
Gene name | yeeV | Uniprot ID | A0A066T988 |
Locus tag | NW339_RS09150 | Protein ID | WP_000854815.1 |
Coordinates | 1921728..1922102 (-) | Length | 125 a.a. |
Antitoxin (Protein)
Gene name | yeeU | Uniprot ID | A0A061Y7A8 |
Locus tag | NW339_RS09155 | Protein ID | WP_001280918.1 |
Coordinates | 1922191..1922559 (-) | Length | 123 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NW339_RS09110 (1917124) | 1917124..1918290 | + | 1167 | WP_001296209.1 | serine-type D-Ala-D-Ala carboxypeptidase DacD | - |
NW339_RS09115 (1918409) | 1918409..1918882 | + | 474 | WP_001105368.1 | DNA gyrase inhibitor SbmC | - |
NW339_RS09120 (1919080) | 1919080..1920138 | + | 1059 | WP_001200889.1 | FUSC family protein | - |
NW339_RS09125 (1920310) | 1920310..1920639 | + | 330 | WP_000450409.1 | DUF496 family protein | - |
NW339_RS09130 (1920740) | 1920740..1921063 | - | 324 | WP_225469267.1 | EutP/PduV family microcompartment system protein | - |
NW339_RS09135 (1921042) | 1921042..1921122 | + | 81 | WP_023441679.1 | hypothetical protein | - |
NW339_RS09140 (1921411) | 1921411..1921491 | - | 81 | Protein_1790 | hypothetical protein | - |
NW339_RS09145 (1921537) | 1921537..1921731 | - | 195 | WP_000988600.1 | DUF5983 family protein | - |
NW339_RS09150 (1921728) | 1921728..1922102 | - | 375 | WP_000854815.1 | type IV toxin-antitoxin system cytoskeleton-binding toxin CbtA | Toxin |
NW339_RS09155 (1922191) | 1922191..1922559 | - | 369 | WP_001280918.1 | type IV toxin-antitoxin system YeeU family antitoxin | Antitoxin |
NW339_RS09160 (1922575) | 1922575..1923219 | - | 645 | WP_000086752.1 | hypothetical protein | - |
NW339_RS09165 (1923238) | 1923238..1923459 | - | 222 | WP_000692345.1 | DUF987 domain-containing protein | - |
NW339_RS09170 (1923522) | 1923522..1923998 | - | 477 | WP_001186200.1 | RadC family protein | - |
NW339_RS09175 (1924014) | 1924014..1924487 | - | 474 | WP_001542276.1 | antirestriction protein | - |
NW339_RS09180 (1924581) | 1924581..1924826 | - | 246 | WP_001164966.1 | hypothetical protein | - |
NW339_RS09185 (1924826) | 1924826..1925644 | - | 819 | WP_001542275.1 | DUF932 domain-containing protein | - |
NW339_RS09190 (1925865) | 1925865..1926275 | - | 411 | WP_000846703.1 | hypothetical protein | - |
NW339_RS09195 (1926291) | 1926291..1926641 | - | 351 | Protein_1801 | hypothetical protein | - |
NW339_RS09200 (1926724) | 1926724..1927470 | - | 747 | WP_001016257.1 | IS21-like element ISEc12 family helper ATPase IstB | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 125 a.a. Molecular weight: 13829.83 Da Isoelectric Point: 7.1326
>T254555 WP_000854815.1 NZ_CP102947:c1922102-1921728 [Escherichia coli]
MKTLPVLPGQAASSRPSPVEIWQILLSRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SACTRSQLINSIDILRARRATGLMTSDNYRTVNNITLGKYPEAK
MKTLPVLPGQAASSRPSPVEIWQILLSRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SACTRSQLINSIDILRARRATGLMTSDNYRTVNNITLGKYPEAK
Download Length: 375 bp
Antitoxin
Download Length: 123 a.a. Molecular weight: 13811.70 Da Isoelectric Point: 6.4767
>AT254555 WP_001280918.1 NZ_CP102947:c1922559-1922191 [Escherichia coli]
VSDKLHETNYPDDHNDRLWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGLFSDADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKGLTCKADTLSSCGYVYLAVYPTPEMKN
VSDKLHETNYPDDHNDRLWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGLFSDADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKGLTCKADTLSSCGYVYLAVYPTPEMKN
Download Length: 369 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A066T988 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A061Y7A8 |