254552

Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type IV Classification (family/domain) yeeUV (cbtA-cbeA)/CbtA-CbeA
Location 819440..820274 Replicon chromosome
Accession NZ_CP102947
Organism Escherichia coli strain SCAID WND1-2022 (119)

Toxin (Protein)


Gene name yeeV Uniprot ID S1PLF5
Locus tag NW339_RS04005 Protein ID WP_000854690.1
Coordinates 819440..819817 (-) Length 126 a.a.

Antitoxin (Protein)


Gene name yeeU Uniprot ID S1P7N8
Locus tag NW339_RS04010 Protein ID WP_001305076.1
Coordinates 819906..820274 (-) Length 123 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NW339_RS03975 (815834) 815834..816004 - 171 Protein_781 IS110 family transposase -
NW339_RS03980 (816421) 816421..817354 - 934 Protein_782 nucleotidyl transferase AbiEii/AbiGii toxin family protein -
NW339_RS03985 (817347) 817347..817742 - 396 WP_000208384.1 DUF6088 family protein -
NW339_RS03990 (817811) 817811..818656 - 846 WP_001529401.1 DUF4942 domain-containing protein -
NW339_RS03995 (818741) 818741..818938 - 198 WP_000839293.1 DUF957 domain-containing protein -
NW339_RS04000 (818955) 818955..819443 - 489 WP_000761699.1 DUF5983 family protein -
NW339_RS04005 (819440) 819440..819817 - 378 WP_000854690.1 TA system toxin CbtA family protein Toxin
NW339_RS04010 (819906) 819906..820274 - 369 WP_001305076.1 type IV toxin-antitoxin system YeeU family antitoxin Antitoxin
NW339_RS04015 (820324) 820324..820968 - 645 WP_000094916.1 hypothetical protein -
NW339_RS04020 (820987) 820987..821208 - 222 WP_000692329.1 DUF987 domain-containing protein -
NW339_RS04025 (821271) 821271..821747 - 477 WP_001186726.1 RadC family protein -
NW339_RS04030 (821763) 821763..822248 - 486 WP_000849565.1 antirestriction protein -
NW339_RS04035 (822303) 822303..823121 - 819 WP_001234620.1 DUF932 domain-containing protein -
NW339_RS04040 (823222) 823222..823455 - 234 WP_000902034.1 DUF905 family protein -
NW339_RS04045 (823534) 823534..823989 - 456 WP_000581502.1 IrmA family protein -
NW339_RS04050 (824065) 824065..825192 - 1128 Protein_796 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Genomic island - kpsS / kpsC / kpsU / kpsD / kpsE / kpsF / sat 802555..870006 67451
- flank IS/Tn - - 815834..815989 155


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

CbtA toxin of type IV toxin-antitoxin system

(1-112)

Antitoxin

Antitoxin CbeA

(18-117)


Sequences

Toxin        


Download         Length: 126 a.a.        Molecular weight: 14057.04 Da        Isoelectric Point: 9.1510

>T254552 WP_000854690.1 NZ_CP102947:c819817-819440 [Escherichia coli]
MKTLPDTHVRAASRCPSPVTIWQTLLTRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYAQVRTDQPGF
SAGAPSQLINSIDILRARRATGLMTRNNYRMVNNITQGKHPEAKR

Download         Length: 378 bp

Antitoxin


Download         Length: 123 a.a.        Molecular weight: 13560.39 Da        Isoelectric Point: 4.7830

>AT254552 WP_001305076.1 NZ_CP102947:c820274-819906 [Escherichia coli]
MSDTLPGTTLPDDNKDLPWWGLPCTVTPCFGACLVQEGNRLHYLADRAGIRGRFSDADAYHPDQAFPLLMKQPELMLTSG
ELNPRHQHTVTLYAKGLTCEADTLGSCDYVYLAVYPTPEMKN

Download         Length: 369 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB S1PLF5

Antitoxin

Source ID Structure
AlphaFold DB S1P7N8

References