Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/VapC-VagC |
Location | 5245901..5246541 | Replicon | chromosome |
Accession | NZ_CP102946 | ||
Organism | Pseudomonas aeruginosa strain SCAID WND1-2022 (148) |
Toxin (Protein)
Gene name | vapC | Uniprot ID | - |
Locus tag | NW341_RS24380 | Protein ID | WP_003105740.1 |
Coordinates | 5245901..5246311 (-) | Length | 137 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | Q6X2S2 |
Locus tag | NW341_RS24385 | Protein ID | WP_003158175.1 |
Coordinates | 5246311..5246541 (-) | Length | 77 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NW341_RS24340 (NW341_24340) | 5241770..5241940 | + | 171 | WP_003159716.1 | hypothetical protein | - |
NW341_RS24345 (NW341_24345) | 5242096..5242824 | + | 729 | WP_003105754.1 | TIGR03761 family integrating conjugative element protein | - |
NW341_RS24350 (NW341_24350) | 5242830..5243378 | + | 549 | WP_003105753.1 | DUF3158 family protein | - |
NW341_RS24355 (NW341_24355) | 5243425..5244264 | + | 840 | WP_003105750.1 | Rha family transcriptional regulator | - |
NW341_RS24360 (NW341_24360) | 5244294..5244782 | + | 489 | WP_003105748.1 | single-stranded DNA-binding protein | - |
NW341_RS24365 (NW341_24365) | 5244938..5245135 | + | 198 | WP_003109353.1 | CrpP family ICE-associated protein | - |
NW341_RS24370 (NW341_24370) | 5245201..5245419 | - | 219 | WP_003105747.1 | hypothetical protein | - |
NW341_RS24375 (NW341_24375) | 5245619..5245879 | - | 261 | WP_003105742.1 | hypothetical protein | - |
NW341_RS24380 (NW341_24380) | 5245901..5246311 | - | 411 | WP_003105740.1 | tRNA(fMet)-specific endonuclease VapC | Toxin |
NW341_RS24385 (NW341_24385) | 5246311..5246541 | - | 231 | WP_003158175.1 | type II toxin-antitoxin system VapB family antitoxin | Antitoxin |
NW341_RS24390 (NW341_24390) | 5246797..5248716 | + | 1920 | WP_004352838.1 | type I DNA topoisomerase | - |
NW341_RS24395 (NW341_24395) | 5249024..5249233 | + | 210 | WP_003105733.1 | cold-shock protein | - |
NW341_RS24400 (NW341_24400) | 5249454..5251343 | + | 1890 | WP_003105732.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Integrative and Conjugative Element | - | - | 5226330..5329158 | 102828 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 137 a.a. Molecular weight: 15450.81 Da Isoelectric Point: 7.3233
>T254547 WP_003105740.1 NZ_CP102946:c5246311-5245901 [Pseudomonas aeruginosa]
MLKFMLDTNICIFTIKNRPQEVREAFLRHHDQMCISTVTLMELIYGAEKSSNPSRNLADVEGFAARLEVLKYDQEAAAHT
GQLRAELARLGKQIGPYDQMIAGHARSQGLIVVTNNRREFDRVPGLRVEDWVVPIV
MLKFMLDTNICIFTIKNRPQEVREAFLRHHDQMCISTVTLMELIYGAEKSSNPSRNLADVEGFAARLEVLKYDQEAAAHT
GQLRAELARLGKQIGPYDQMIAGHARSQGLIVVTNNRREFDRVPGLRVEDWVVPIV
Download Length: 411 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|