Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | parDE/RHH(antitoxin) |
Location | 141537..142042 | Replicon | chromosome |
Accession | NZ_CP102946 | ||
Organism | Pseudomonas aeruginosa strain SCAID WND1-2022 (148) |
Toxin (Protein)
Gene name | parE | Uniprot ID | A0A069QL22 |
Locus tag | NW341_RS00645 | Protein ID | WP_003121619.1 |
Coordinates | 141537..141818 (-) | Length | 94 a.a. |
Antitoxin (Protein)
Gene name | parD | Uniprot ID | Q9I707 |
Locus tag | NW341_RS00650 | Protein ID | WP_003112628.1 |
Coordinates | 141815..142042 (-) | Length | 76 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NW341_RS00620 (NW341_00620) | 136788..138137 | + | 1350 | WP_003119513.1 | C4-dicarboxylate transporter DctA | - |
NW341_RS00625 (NW341_00625) | 138186..138872 | + | 687 | WP_033877486.1 | FadR/GntR family transcriptional regulator | - |
NW341_RS00630 (NW341_00630) | 138973..139707 | + | 735 | WP_004346926.1 | GntR family transcriptional regulator | - |
NW341_RS00635 (NW341_00635) | 139887..140297 | + | 411 | WP_003101225.1 | aegerolysin family protein | - |
NW341_RS00640 (NW341_00640) | 140329..141237 | - | 909 | WP_003083769.1 | LysR family transcriptional regulator | - |
NW341_RS00645 (NW341_00645) | 141537..141818 | - | 282 | WP_003121619.1 | type II toxin-antitoxin system toxin ParE | Toxin |
NW341_RS00650 (NW341_00650) | 141815..142042 | - | 228 | WP_003112628.1 | CopG family ribbon-helix-helix protein | Antitoxin |
NW341_RS00655 (NW341_00655) | 142218..142838 | - | 621 | WP_023088714.1 | hypothetical protein | - |
NW341_RS00660 (NW341_00660) | 142939..143439 | + | 501 | WP_003101228.1 | LEA type 2 family protein | - |
NW341_RS00665 (NW341_00665) | 143512..143853 | + | 342 | WP_003101229.1 | zinc ribbon domain-containing protein YjdM | - |
NW341_RS00670 (NW341_00670) | 143935..145362 | - | 1428 | WP_003083784.1 | GABA permease | - |
NW341_RS00675 (NW341_00675) | 145531..147024 | - | 1494 | WP_003083788.1 | CoA-acylating methylmalonate-semialdehyde dehydrogenase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 94 a.a. Molecular weight: 10492.22 Da Isoelectric Point: 10.0435
>T254542 WP_003121619.1 NZ_CP102946:c141818-141537 [Pseudomonas aeruginosa]
MSLKWTRKAAADLDTIYDHYVVLIGPEKALKAVQDIVEQVKPLQQVANQGAGRPSEVPGVRTLTLERWPFSAPFRVKGKE
IQILRIDRVEITP
MSLKWTRKAAADLDTIYDHYVVLIGPEKALKAVQDIVEQVKPLQQVANQGAGRPSEVPGVRTLTLERWPFSAPFRVKGKE
IQILRIDRVEITP
Download Length: 282 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A069QL22 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | Q9I707 |