Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | mazEF/MazF(toxin) |
Location | 2105710..2106239 | Replicon | chromosome |
Accession | NZ_CP102945 | ||
Organism | Staphylococcus aureus strain SCAID OTT1-2022 (150) |
Toxin (Protein)
Gene name | mazF | Uniprot ID | - |
Locus tag | NW338_RS10525 | Protein ID | WP_000621177.1 |
Coordinates | 2105710..2106072 (-) | Length | 121 a.a. |
Antitoxin (Protein)
Gene name | mazE | Uniprot ID | T1YCG8 |
Locus tag | NW338_RS10530 | Protein ID | WP_000948331.1 |
Coordinates | 2106069..2106239 (-) | Length | 57 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NW338_RS10505 (2102688) | 2102688..2103458 | - | 771 | WP_258389928.1 | RNA polymerase sigma factor SigB | - |
NW338_RS10510 (2103433) | 2103433..2103912 | - | 480 | WP_258389929.1 | anti-sigma B factor RsbW | - |
NW338_RS10515 (2103914) | 2103914..2104240 | - | 327 | WP_001052491.1 | anti-sigma factor antagonist | - |
NW338_RS10520 (2104359) | 2104359..2105360 | - | 1002 | WP_000390829.1 | PP2C family protein-serine/threonine phosphatase | - |
NW338_RS10525 (2105710) | 2105710..2106072 | - | 363 | WP_000621177.1 | type II toxin-antitoxin system PemK/MazF family toxin | Toxin |
NW338_RS10530 (2106069) | 2106069..2106239 | - | 171 | WP_000948331.1 | type II toxin-antitoxin system antitoxin MazE | Antitoxin |
NW338_RS10535 (2106324) | 2106324..2107472 | - | 1149 | WP_001281147.1 | alanine racemase | - |
NW338_RS10540 (2107538) | 2107538..2107897 | - | 360 | WP_000581202.1 | holo-ACP synthase | - |
NW338_RS10545 (2107901) | 2107901..2108392 | - | 492 | WP_001205910.1 | PH domain-containing protein | - |
NW338_RS10550 (2108379) | 2108379..2109962 | - | 1584 | WP_001294627.1 | PH domain-containing protein | - |
NW338_RS10555 (2109955) | 2109955..2110434 | - | 480 | WP_001287078.1 | hypothetical protein | - |
NW338_RS10560 (2110643) | 2110643..2111203 | - | 561 | WP_001092409.1 | K(+)-transporting ATPase subunit C | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 121 a.a. Molecular weight: 13471.72 Da Isoelectric Point: 10.1654
>T254536 WP_000621177.1 NZ_CP102945:c2106072-2105710 [Staphylococcus aureus]
MIRRGDVYLADLSPVQGSEQGGVRPVVIIQNDTGNKYSPTVIVAAITGRINKAKIPTHVEIEKKKYKLDKDSVILLEQIR
TLDKKRLKEKLTYLSDDKMKEVDNALMISLGLNTVAHQKN
MIRRGDVYLADLSPVQGSEQGGVRPVVIIQNDTGNKYSPTVIVAAITGRINKAKIPTHVEIEKKKYKLDKDSVILLEQIR
TLDKKRLKEKLTYLSDDKMKEVDNALMISLGLNTVAHQKN
Download Length: 363 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|