Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | tsbAT/- |
| Location | 1895467..1896243 | Replicon | chromosome |
| Accession | NZ_CP102945 | ||
| Organism | Staphylococcus aureus strain SCAID OTT1-2022 (150) | ||
Toxin (Protein)
| Gene name | tsbT | Uniprot ID | X5E2E6 |
| Locus tag | NW338_RS09215 | Protein ID | WP_000031108.1 |
| Coordinates | 1895467..1895619 (-) | Length | 51 a.a. |
Antitoxin (Protein)
| Gene name | tsbA | Uniprot ID | W8U4V4 |
| Locus tag | NW338_RS09220 | Protein ID | WP_001251224.1 |
| Coordinates | 1895644..1896243 (-) | Length | 200 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NW338_RS09200 (1891658) | 1891658..1892479 | + | 822 | WP_000669376.1 | RluA family pseudouridine synthase | - |
| NW338_RS09205 (1892943) | 1892943..1894328 | - | 1386 | WP_000116234.1 | class II fumarate hydratase | - |
| NW338_RS09210 (1894524) | 1894524..1894919 | - | 396 | WP_000901023.1 | hypothetical protein | - |
| NW338_RS09215 (1895467) | 1895467..1895619 | - | 153 | WP_000031108.1 | SAS053 family protein | Toxin |
| NW338_RS09220 (1895644) | 1895644..1896243 | - | 600 | WP_001251224.1 | glucosamine-6-phosphate isomerase | Antitoxin |
| NW338_RS09225 (1896402) | 1896402..1896872 | - | 471 | WP_000181392.1 | tRNA (uridine(34)/cytosine(34)/5- carboxymethylaminomethyluridine(34)-2'-O)- methyltransferase TrmL | - |
| NW338_RS09230 (1896877) | 1896877..1898004 | - | 1128 | WP_000379980.1 | tRNA epoxyqueuosine(34) reductase QueG | - |
| NW338_RS09235 (1898155) | 1898155..1898877 | - | 723 | WP_000590809.1 | amino acid ABC transporter ATP-binding protein | - |
| NW338_RS09240 (1898870) | 1898870..1900327 | - | 1458 | WP_000649908.1 | ABC transporter permease subunit | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 51 a.a. Molecular weight: 5936.28 Da Isoelectric Point: 3.8962
>T254531 WP_000031108.1 NZ_CP102945:c1895619-1895467 [Staphylococcus aureus]
MSKDKDPKLNYHEEENSMVTDFEDLKELGKEMEQISDQNDQEKNSEEDSQ
MSKDKDPKLNYHEEENSMVTDFEDLKELGKEMEQISDQNDQEKNSEEDSQ
Download Length: 153 bp
Antitoxin
Download Length: 200 a.a. Molecular weight: 22343.47 Da Isoelectric Point: 5.1445
>AT254531 WP_001251224.1 NZ_CP102945:c1896243-1895644 [Staphylococcus aureus]
MAMNFKVFDNSQLVAEYAADIIRKQFNNNPTTIAGFHLDTDQAPVLDELKKNVEKHAVDFSQINILDYDDKKSYFEALGV
PAGQVYPIAYEKDAIELIADKIKTKENKGKLTLQVVSIDEQGKLNVSIRQGLMEAREIFLVVTGANKRDVVEKLYQENGK
TSFEPADLKAHRMVNVILDKEAAAGLPEDVKAYFTSRFA
MAMNFKVFDNSQLVAEYAADIIRKQFNNNPTTIAGFHLDTDQAPVLDELKKNVEKHAVDFSQINILDYDDKKSYFEALGV
PAGQVYPIAYEKDAIELIADKIKTKENKGKLTLQVVSIDEQGKLNVSIRQGLMEAREIFLVVTGANKRDVVEKLYQENGK
TSFEPADLKAHRMVNVILDKEAAAGLPEDVKAYFTSRFA
Download Length: 600 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|