Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) TsaAT/-
Location 814486..814963 Replicon chromosome
Accession NZ_CP102945
Organism Staphylococcus aureus strain SCAID OTT1-2022 (150)

Toxin (Protein)


Gene name TsaT Uniprot ID T1Y7S2
Locus tag NW338_RS03890 Protein ID WP_000052076.1
Coordinates 814486..814674 (-) Length 63 a.a.

Antitoxin (Protein)


Gene name TsaA Uniprot ID T1Y6P8
Locus tag NW338_RS03895 Protein ID WP_001059690.1
Coordinates 814703..814963 (-) Length 87 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NW338_RS03860 (810480) 810480..811001 + 522 WP_000824482.1 hypothetical protein -
NW338_RS03865 (811342) 811342..812028 + 687 WP_000141557.1 thermonuclease family protein -
NW338_RS03870 (812385) 812385..812585 + 201 WP_001059082.1 cold-shock protein -
NW338_RS03875 (813077) 813077..813295 - 219 WP_000005886.1 hypothetical protein -
NW338_RS03880 (813357) 813357..813641 - 285 WP_001004399.1 hypothetical protein -
NW338_RS03885 (813729) 813729..814298 - 570 WP_001106654.1 lipoprotein N-acylation protein LnsA -
NW338_RS03890 (814486) 814486..814674 - 189 WP_000052076.1 hypothetical protein Toxin
NW338_RS03895 (814703) 814703..814963 - 261 WP_001059690.1 hypothetical protein Antitoxin
NW338_RS03900 (815304) 815304..815507 + 204 WP_000145163.1 sterile alpha motif-like domain-containing protein -
NW338_RS03905 (815504) 815504..815740 - 237 WP_000349581.1 hypothetical protein -
NW338_RS03910 (815965) 815965..816546 + 582 WP_001140693.1 histidine phosphatase family protein -
NW338_RS03915 (816619) 816619..817236 - 618 WP_000255551.1 LysE/ArgO family amino acid transporter -
NW338_RS03920 (817391) 817391..817885 - 495 WP_000569884.1 GNAT family N-acetyltransferase -
NW338_RS03925 (818284) 818284..818706 - 423 WP_000974460.1 organic hydroperoxide resistance protein -
NW338_RS03930 (818854) 818854..819570 + 717 WP_000150011.1 type I 3-dehydroquinate dehydratase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin


No domain identified.


Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 63 a.a.        Molecular weight: 7142.82 Da        Isoelectric Point: 9.9971

>T254530 WP_000052076.1 NZ_CP102945:c814674-814486 [Staphylococcus aureus]
MSLHFAILFWLALIFLVAATFILVLMKKTGKESKKESYLSFTVILYIFGFAILIYTFIFGVL

Download         Length: 189 bp

Antitoxin


Download         Length: 87 a.a.        Molecular weight: 9940.09 Da        Isoelectric Point: 4.0624

>AT254530 WP_001059690.1 NZ_CP102945:c814963-814703 [Staphylococcus aureus]
MNNILLNAINIVITTTFVIFNILITYNKDLDDLCWLLPGIIICGVILIVSFTIAMITKNWLSEILFFINIVLVLYYIYPI
FYSFIG

Download         Length: 261 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A0E0VP18

Antitoxin

Source ID Structure
AlphaFold DB A0A0E0VN56

References