Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | PumAB/COG3657-dnstrm_HI1420 |
Location | 5548806..5549392 | Replicon | chromosome |
Accession | NZ_CP102944 | ||
Organism | Pseudomonas aeruginosa strain SCAID TCT1-2022 (325) |
Toxin (Protein)
Gene name | PumA | Uniprot ID | G8CP73 |
Locus tag | NW342_RS26050 | Protein ID | WP_003120987.1 |
Coordinates | 5549093..5549392 (-) | Length | 100 a.a. |
Antitoxin (Protein)
Gene name | PumB | Uniprot ID | - |
Locus tag | NW342_RS26045 | Protein ID | WP_003448662.1 |
Coordinates | 5548806..5549096 (-) | Length | 97 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NW342_RS26030 (NW342_26030) | 5544381..5546276 | + | 1896 | WP_202551604.1 | hypothetical protein | - |
NW342_RS26035 (NW342_26035) | 5546273..5548249 | + | 1977 | WP_022579622.1 | DEAD/DEAH box helicase | - |
NW342_RS26040 (NW342_26040) | 5548388..5548723 | + | 336 | WP_022579623.1 | hypothetical protein | - |
NW342_RS26045 (NW342_26045) | 5548806..5549096 | - | 291 | WP_003448662.1 | putative addiction module antidote protein | Antitoxin |
NW342_RS26050 (NW342_26050) | 5549093..5549392 | - | 300 | WP_003120987.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
NW342_RS26055 (NW342_26055) | 5549594..5550718 | + | 1125 | WP_023093672.1 | TcpQ domain-containing protein | - |
NW342_RS26060 (NW342_26060) | 5550718..5552427 | + | 1710 | WP_023093673.1 | PilN family type IVB pilus formation outer membrane protein | - |
NW342_RS26065 (NW342_26065) | 5552431..5553756 | + | 1326 | WP_022579625.1 | type 4b pilus protein PilO2 | - |
NW342_RS26070 (NW342_26070) | 5553746..5554279 | + | 534 | WP_004352829.1 | type IV pilus biogenesis protein PilP | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Integrative and Conjugative Element | - | - | 5518957..5607929 | 88972 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 100 a.a. Molecular weight: 11133.88 Da Isoelectric Point: 10.4495
>T254528 WP_003120987.1 NZ_CP102944:c5549392-5549093 [Pseudomonas aeruginosa]
MVEVKQTATFMAWESKLKDRRAKAVIAARIFRLANGLPGDVSPVGQGVSELRIHYGPGYRVYFQQRGTEIVILLCGGDKS
SQARDIEMAKRLANEWRPQ
MVEVKQTATFMAWESKLKDRRAKAVIAARIFRLANGLPGDVSPVGQGVSELRIHYGPGYRVYFQQRGTEIVILLCGGDKS
SQARDIEMAKRLANEWRPQ
Download Length: 300 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|