Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | PfiT-PfiA/ParE(toxin) |
Location | 5146645..5147253 | Replicon | chromosome |
Accession | NZ_CP102944 | ||
Organism | Pseudomonas aeruginosa strain SCAID TCT1-2022 (325) |
Toxin (Protein)
Gene name | PfiT | Uniprot ID | A0A444LUU5 |
Locus tag | NW342_RS24185 | Protein ID | WP_019486378.1 |
Coordinates | 5146645..5146992 (-) | Length | 116 a.a. |
Antitoxin (Protein)
Gene name | PfiA | Uniprot ID | A0A0B0C355 |
Locus tag | NW342_RS24190 | Protein ID | WP_003114155.1 |
Coordinates | 5147002..5147253 (-) | Length | 84 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NW342_RS24155 (NW342_24155) | 5142004..5142276 | + | 273 | WP_074241374.1 | cysteine-rich CWC family protein | - |
NW342_RS24160 (NW342_24160) | 5142276..5142968 | + | 693 | WP_003085458.1 | 16S rRNA pseudouridine(516) synthase | - |
NW342_RS24165 (NW342_24165) | 5143104..5144147 | + | 1044 | WP_003134392.1 | L,D-transpeptidase | - |
NW342_RS24170 (NW342_24170) | 5144227..5144964 | + | 738 | WP_003085453.1 | murein L,D-transpeptidase catalytic domain family protein | - |
NW342_RS24175 (NW342_24175) | 5145416..5146318 | + | 903 | WP_003085447.1 | (R)-3-hydroxydecanoyl-ACP:CoA transacylase | - |
NW342_RS24185 (NW342_24185) | 5146645..5146992 | - | 348 | WP_019486378.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
NW342_RS24190 (NW342_24190) | 5147002..5147253 | - | 252 | WP_003114155.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
NW342_RS24195 (NW342_24195) | 5147467..5148450 | - | 984 | WP_033990852.1 | tyrosine-type recombinase/integrase | - |
NW342_RS24200 (NW342_24200) | 5148450..5149742 | - | 1293 | WP_033990854.1 | hypothetical protein | - |
NW342_RS24205 (NW342_24205) | 5149972..5151246 | - | 1275 | WP_033990855.1 | zonular occludens toxin family protein | - |
NW342_RS24210 (NW342_24210) | 5151250..5151606 | - | 357 | WP_003114150.1 | DUF2523 family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Prophage | catB7 | - | 5146645..5172349 | 25704 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 116 a.a. Molecular weight: 12956.72 Da Isoelectric Point: 4.4212
>T254527 WP_019486378.1 NZ_CP102944:c5146992-5146645 [Pseudomonas aeruginosa]
MSPVVIRFTDTAEQSIEDQVHHLAPFQGEQAALQSVLSLLDEIEEKISLAPKGYPVSQQASLLGVLSYRELNTGPYRVFY
EFHEEQGEAAVILVLRQKQSVEQQLIRYCLVGPIE
MSPVVIRFTDTAEQSIEDQVHHLAPFQGEQAALQSVLSLLDEIEEKISLAPKGYPVSQQASLLGVLSYRELNTGPYRVFY
EFHEEQGEAAVILVLRQKQSVEQQLIRYCLVGPIE
Download Length: 348 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A444LUU5 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0B0C355 |