Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) relB-parE/ParE-RHH
Location 168535..169103 Replicon chromosome
Accession NZ_CP102944
Organism Pseudomonas aeruginosa strain SCAID TCT1-2022 (325)

Toxin (Protein)


Gene name parE Uniprot ID A0A0D0R3P1
Locus tag NW342_RS00815 Protein ID WP_011222050.1
Coordinates 168810..169103 (+) Length 98 a.a.

Antitoxin (Protein)


Gene name relB Uniprot ID A0A6M3UV67
Locus tag NW342_RS00810 Protein ID WP_011222051.1
Coordinates 168535..168822 (+) Length 96 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NW342_RS00785 (NW342_00785) 163811..164650 + 840 WP_000259031.1 sulfonamide-resistant dihydropteroate synthase Sul1 -
NW342_RS00790 (NW342_00790) 164778..165278 + 501 WP_000376623.1 GNAT family N-acetyltransferase -
NW342_RS00795 (NW342_00795) 165247..166239 - 993 WP_001381192.1 TniB family NTP-binding protein -
NW342_RS00800 (NW342_00800) 166242..167921 - 1680 WP_000179844.1 DDE-type integrase/transposase/recombinase -
NW342_RS00805 (NW342_00805) 168156..168362 + 207 WP_033991586.1 hypothetical protein -
NW342_RS00810 (NW342_00810) 168535..168822 + 288 WP_011222051.1 CopG family ribbon-helix-helix protein Antitoxin
NW342_RS00815 (NW342_00815) 168810..169103 + 294 WP_011222050.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
NW342_RS00820 (NW342_00820) 169113..169286 - 174 Protein_163 acyloxyacyl hydrolase -
NW342_RS00825 (NW342_00825) 169388..169576 - 189 Protein_164 multidrug transporter -
NW342_RS00830 (NW342_00830) 170002..170244 + 243 WP_000844627.1 transposase -
NW342_RS00835 (NW342_00835) 170276..170926 - 651 WP_000164043.1 tetracycline resistance transcriptional repressor TetR(A) -
NW342_RS00840 (NW342_00840) 171032..172222 + 1191 WP_033991588.1 tetracycline efflux MFS transporter Tet(A) -
NW342_RS00845 (NW342_00845) 172956..173855 - 900 WP_032494864.1 extended-spectrum class A beta-lactamase VEB-9 -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Genomic island blaOXA-10 / ant(3'')-Ia / sul1 / tet(A) / blaVEB-1 - 103312..188208 84896


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, RelE/ParE toxin family

(4-94)

Antitoxin

Ribbon-helix-helix protein, CopG

(9-45)


Sequences

Toxin        


Download         Length: 98 a.a.        Molecular weight: 10890.71 Da        Isoelectric Point: 10.8518

>T254522 WP_011222050.1 NZ_CP102944:168810-169103 [Pseudomonas aeruginosa]
MPQVILSPAALRDLKRLREFLHSKSPVVAQRAAQTIRSALAQLGQQPAMGRPIEGLPEVFREWVIPFGDSGYLARYRLEG
ETVVILALRHQREAGFI

Download         Length: 294 bp

Antitoxin


Download         Length: 96 a.a.        Molecular weight: 10922.19 Da        Isoelectric Point: 5.1897

>AT254522 WP_011222051.1 NZ_CP102944:168535-168822 [Pseudomonas aeruginosa]
MSAATKPMSIKLDSDTQSRIKQLAAARDRSAHWMMREAITQYVEREERKEAFRRDTLDAWQEFQETGLHVSLEETDQWLA
GWGTEIEGGAPACHK

Download         Length: 288 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A0D0R3P1

Antitoxin

Source ID Structure
AlphaFold DB A0A6M3UV67

References