Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | PumAB/upstrm_HI1419-dnstrm_HI1420 |
Location | 265359..266007 | Replicon | chromosome |
Accession | NZ_CP102942 | ||
Organism | Stenotrophomonas maltophilia strain SCAID WND1-2022 (370) |
Toxin (Protein)
Gene name | PumA | Uniprot ID | B2FJ07 |
Locus tag | NW343_RS01185 | Protein ID | WP_012478870.1 |
Coordinates | 265359..265646 (+) | Length | 96 a.a. |
Antitoxin (Protein)
Gene name | PumB | Uniprot ID | - |
Locus tag | NW343_RS01190 | Protein ID | WP_012478871.1 |
Coordinates | 265705..266007 (+) | Length | 101 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NW343_RS01155 (NW343_01155) | 260619..261587 | + | 969 | WP_012478821.1 | bifunctional biotin--[acetyl-CoA-carboxylase] ligase/biotin operon repressor BirA | - |
NW343_RS01160 (NW343_01160) | 261584..262315 | + | 732 | WP_005407698.1 | type III pantothenate kinase | - |
NW343_RS01165 (NW343_01165) | 262325..263173 | + | 849 | WP_049417982.1 | SPOR domain-containing protein | - |
NW343_RS01175 (NW343_01175) | 263374..264498 | - | 1125 | WP_012478868.1 | hypothetical protein | - |
NW343_RS01180 (NW343_01180) | 264526..265125 | - | 600 | WP_012478869.1 | hypothetical protein | - |
NW343_RS01185 (NW343_01185) | 265359..265646 | + | 288 | WP_012478870.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
NW343_RS01190 (NW343_01190) | 265705..266007 | + | 303 | WP_012478871.1 | putative addiction module antidote protein | Antitoxin |
NW343_RS01195 (NW343_01195) | 266065..266388 | - | 324 | WP_012478872.1 | hypothetical protein | - |
NW343_RS01200 (NW343_01200) | 266468..266875 | - | 408 | WP_044569408.1 | hypothetical protein | - |
NW343_RS01205 (NW343_01205) | 267469..268239 | + | 771 | WP_012478874.1 | DUF3011 domain-containing protein | - |
NW343_RS01210 (NW343_01210) | 268236..269243 | + | 1008 | WP_232092433.1 | ankyrin repeat domain-containing protein | - |
NW343_RS01215 (NW343_01215) | 269348..270268 | + | 921 | WP_005407709.1 | arginase | - |
NW343_RS01220 (NW343_01220) | 270429..270566 | + | 138 | WP_005407710.1 | entericidin A/B family lipoprotein | - |
NW343_RS01225 (NW343_01225) | 270774..270995 | + | 222 | WP_004153772.1 | CsbD family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 96 a.a. Molecular weight: 10802.42 Da Isoelectric Point: 10.8940
>T254521 WP_012478870.1 NZ_CP102942:265359-265646 [Stenotrophomonas maltophilia]
MKIQRTRQFATWIDALKDVTARARILARIGRLAEGHPGDHRYLGDGISELRIDAGPGYRLYYTQRGRQLLILLVGGDKSS
QQRDIEKAREIARAL
MKIQRTRQFATWIDALKDVTARARILARIGRLAEGHPGDHRYLGDGISELRIDAGPGYRLYYTQRGRQLLILLVGGDKSS
QQRDIEKAREIARAL
Download Length: 288 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|