Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | kacAT/DUF1778(antitoxin) |
Location | 4648898..4649708 | Replicon | chromosome |
Accession | NZ_CP102940 | ||
Organism | Klebsiella pneumoniae strain SCAID PND1-2022 (426) |
Toxin (Protein)
Gene name | KacT | Uniprot ID | A0A060VJ83 |
Locus tag | NW340_RS22680 | Protein ID | WP_004178461.1 |
Coordinates | 4648898..4649431 (-) | Length | 178 a.a. |
Antitoxin (Protein)
Gene name | KacA | Uniprot ID | J2E9Q7 |
Locus tag | NW340_RS22685 | Protein ID | WP_002887278.1 |
Coordinates | 4649442..4649708 (-) | Length | 89 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NW340_RS22675 (4647729) | 4647729..4648850 | + | 1122 | WP_004214138.1 | cupin domain-containing protein | - |
NW340_RS22680 (4648898) | 4648898..4649431 | - | 534 | WP_004178461.1 | type II toxin-antitoxin system toxin KacT | Toxin |
NW340_RS22685 (4649442) | 4649442..4649708 | - | 267 | WP_002887278.1 | type II toxin-antitoxin system antitoxin KacA | Antitoxin |
NW340_RS22690 (4649811) | 4649811..4651244 | - | 1434 | WP_032418099.1 | Cu(+)/Ag(+) sensor histidine kinase | - |
NW340_RS22695 (4651234) | 4651234..4651917 | - | 684 | WP_002887273.1 | copper response regulator transcription factor CusR | - |
NW340_RS22700 (4652089) | 4652089..4653474 | + | 1386 | WP_032418101.1 | efflux transporter outer membrane subunit | - |
NW340_RS22705 (4653492) | 4653492..4653836 | + | 345 | WP_258383262.1 | cation efflux system protein CusF | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 178 a.a. Molecular weight: 19810.65 Da Isoelectric Point: 5.2614
>T254516 WP_004178461.1 NZ_CP102940:c4649431-4648898 [Klebsiella pneumoniae]
MEQQLTIEMIADAFSYDITGFDCGEEALNTFLKEHLKRQHDGQILRGYALVSGDTVPRLLGYYTLSGSCFERGMLPSKTQ
QKKIPYQNAPSVTLGRLAIDKSVQGQGWGEMLVAHAMRVVWGASKAVGIYGLFVEALNEKAKAFYLRLGFIQLVDENSNL
LFYPTKSIEQLFTDDES
MEQQLTIEMIADAFSYDITGFDCGEEALNTFLKEHLKRQHDGQILRGYALVSGDTVPRLLGYYTLSGSCFERGMLPSKTQ
QKKIPYQNAPSVTLGRLAIDKSVQGQGWGEMLVAHAMRVVWGASKAVGIYGLFVEALNEKAKAFYLRLGFIQLVDENSNL
LFYPTKSIEQLFTDDES
Download Length: 534 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A060VJ83 |
Antitoxin
Source | ID | Structure |
---|---|---|
PDB | 5ZGN | |
AlphaFold DB | A0A0H3GLZ1 |