Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) Hha-TomB/-
Location 4040349..4040968 Replicon chromosome
Accession NZ_CP102940
Organism Klebsiella pneumoniae strain SCAID PND1-2022 (426)

Toxin (Protein)


Gene name Hha Uniprot ID R8WYV2
Locus tag NW340_RS19710 Protein ID WP_002892050.1
Coordinates 4040750..4040968 (+) Length 73 a.a.

Antitoxin (Protein)


Gene name TomB Uniprot ID J2DPF6
Locus tag NW340_RS19705 Protein ID WP_002892066.1
Coordinates 4040349..4040723 (+) Length 125 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NW340_RS19695 (4035501) 4035501..4036694 + 1194 WP_004177236.1 multidrug efflux RND transporter periplasmic adaptor subunit AcrA -
NW340_RS19700 (4036717) 4036717..4039863 + 3147 WP_002892069.1 multidrug efflux RND transporter permease subunit AcrB -
NW340_RS19705 (4040349) 4040349..4040723 + 375 WP_002892066.1 Hha toxicity modulator TomB Antitoxin
NW340_RS19710 (4040750) 4040750..4040968 + 219 WP_002892050.1 HHA domain-containing protein Toxin
NW340_RS19715 (4041127) 4041127..4041693 + 567 WP_002892030.1 maltose O-acetyltransferase -
NW340_RS19720 (4041665) 4041665..4041805 - 141 WP_004147370.1 hypothetical protein -
NW340_RS19725 (4041826) 4041826..4042296 + 471 WP_002892026.1 YlaC family protein -
NW340_RS19730 (4042271) 4042271..4043722 - 1452 WP_002892023.1 PLP-dependent aminotransferase family protein -
NW340_RS19735 (4043823) 4043823..4044521 + 699 WP_002892021.1 GNAT family protein -
NW340_RS19740 (4044518) 4044518..4044658 - 141 WP_002892018.1 type B 50S ribosomal protein L36 -
NW340_RS19745 (4044658) 4044658..4044921 - 264 WP_002892011.1 type B 50S ribosomal protein L31 -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Haemolysin expression modulating, HHA

(13-69)

Antitoxin

Biofilm formation regulator YbaJ

(1-116)


Sequences

Toxin        


Download         Length: 73 a.a.        Molecular weight: 8628.00 Da        Isoelectric Point: 8.9008

>T254515 WP_002892050.1 NZ_CP102940:4040750-4040968 [Klebsiella pneumoniae]
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPTSVWKFIR

Download         Length: 219 bp

Antitoxin


Download         Length: 125 a.a.        Molecular weight: 14368.06 Da        Isoelectric Point: 4.8989

>AT254515 WP_002892066.1 NZ_CP102940:4040349-4040723 [Klebsiella pneumoniae]
MDEYSPKRHDIAQLRFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYAEDNKLIAQVDEYL
DDTFTLFSNYGINSTDLQKWKKSGNRLFRCFVNASRENPASLSC

Download         Length: 375 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A2P8K6F2

Antitoxin

Source ID Structure
AlphaFold DB A0A0H3GJ93

References