Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) phd-doc/Doc-RelB
Location 322931..323517 Replicon chromosome
Accession NZ_CP102940
Organism Klebsiella pneumoniae strain SCAID PND1-2022 (426)

Toxin (Protein)


Gene name doc Uniprot ID W8VD46
Locus tag NW340_RS01495 Protein ID WP_002920800.1
Coordinates 323149..323517 (+) Length 123 a.a.

Antitoxin (Protein)


Gene name phd Uniprot ID W9B1V1
Locus tag NW340_RS01490 Protein ID WP_004174006.1
Coordinates 322931..323152 (+) Length 74 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NW340_RS01470 (319088) 319088..320014 + 927 WP_002920807.1 high-affinity branched-chain amino acid ABC transporter permease LivH -
NW340_RS01475 (320011) 320011..321288 + 1278 WP_004174005.1 branched chain amino acid ABC transporter permease LivM -
NW340_RS01480 (321285) 321285..322052 + 768 WP_002920803.1 high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivG -
NW340_RS01485 (322054) 322054..322767 + 714 WP_004145133.1 high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivF -
NW340_RS01490 (322931) 322931..323152 + 222 WP_004174006.1 type II toxin-antitoxin system Phd/YefM family antitoxin Antitoxin
NW340_RS01495 (323149) 323149..323517 + 369 WP_002920800.1 type II toxin-antitoxin system death-on-curing family toxin Toxin
NW340_RS01500 (323790) 323790..325106 + 1317 WP_004174008.1 sn-glycerol-3-phosphate ABC transporter substrate-binding protein UgpB -
NW340_RS01505 (325213) 325213..326100 + 888 WP_002920792.1 sn-glycerol-3-phosphate ABC transporter permease UgpA -
NW340_RS01510 (326097) 326097..326942 + 846 WP_004145129.1 sn-glycerol-3-phosphate ABC transporter permease UgpE -
NW340_RS01515 (326944) 326944..328014 + 1071 WP_114258166.1 sn-glycerol-3-phosphate import ATP-binding protein UgpC -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Prophage - - 320011..331539 11528


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Fido domain

(13-86)

Antitoxin

Type II toxin-antitoxin system, antitoxin Phd/YefM

(1-50)


Sequences

Toxin        


Download         Length: 123 a.a.        Molecular weight: 13552.92 Da        Isoelectric Point: 8.6410

>T254507 WP_002920800.1 NZ_CP102940:323149-323517 [Klebsiella pneumoniae]
MTLQIISAEEIIQFHDRLLRVTPGVAGMPDPGRAEAIMYRVLNKIEYEGVTDVWRLAAMHLLAISRGHIFNDGNKRTALF
ITLLFLKRNGIILPANPDFVGMTVEAAAGQLTLEQIVARLRG

Download         Length: 369 bp

Antitoxin


Download         Length: 74 a.a.        Molecular weight: 8151.15 Da        Isoelectric Point: 4.7769

>AT254507 WP_004174006.1 NZ_CP102940:322931-323152 [Klebsiella pneumoniae]
MRTVNYSEARQNLADVLESAVTGVPVTITRRGHKSAVIISAEEFERYQAARMDDEFAAIMAVHGDEIRELADK

Download         Length: 222 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A0H3GUD1

Antitoxin

Source ID Structure
AlphaFold DB A0A5E5YJY7

References