Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) relBE/ParE-RelB
Location 21016..21544 Replicon plasmid unnamed2
Accession NZ_CP102936
Organism Acinetobacter sp. AOR07_HL

Toxin (Protein)


Gene name relE Uniprot ID N9N871
Locus tag MKL45_RS18990 Protein ID WP_000221358.1
Coordinates 21251..21544 (+) Length 98 a.a.

Antitoxin (Protein)


Gene name relB Uniprot ID N9NWT9
Locus tag MKL45_RS18985 Protein ID WP_000246755.1
Coordinates 21016..21261 (+) Length 82 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
MKL45_RS18960 (MKL45_18965) 16503..17108 + 606 WP_000447788.1 LysE family translocator -
MKL45_RS18965 (MKL45_18970) 17327..17638 + 312 WP_063454728.1 BrnT family toxin -
MKL45_RS18970 (MKL45_18975) 17601..17915 + 315 WP_038350244.1 BrnA antitoxin family protein -
MKL45_RS18975 (MKL45_18980) 18085..18969 - 885 WP_000155092.1 Mph(E) family macrolide 2'-phosphotransferase -
MKL45_RS18980 (MKL45_18985) 19025..20500 - 1476 WP_000052512.1 ABC-F type ribosomal protection protein Msr(E) -
MKL45_RS18985 (MKL45_18990) 21016..21261 + 246 WP_000246755.1 type II toxin-antitoxin system RelB/DinJ family antitoxin Antitoxin
MKL45_RS18990 (MKL45_18995) 21251..21544 + 294 WP_000221358.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
MKL45_RS18995 (MKL45_19000) 21756..22459 - 704 Protein_21 IS6-like element IS26 family transposase -
MKL45_RS19000 (MKL45_19005) 22657..23160 + 504 Protein_22 Tn3 family transposase -
MKL45_RS19005 (MKL45_19010) 23266..24126 + 861 WP_000557454.1 aminoglycoside N-acetyltransferase AAC(3)-IId -
MKL45_RS19010 (MKL45_19015) 24139..24681 + 543 WP_000587837.1 AAA family ATPase -
MKL45_RS19015 (MKL45_19020) 25163..25354 - 192 WP_000951934.1 hypothetical protein -
MKL45_RS19020 (MKL45_19025) 25378..25605 + 228 WP_000248278.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Non-Mobilizable plasmid blaOXA-58 / mph(E) / msr(E) / aac(3)-IId / sul2 / aph(3'')-Ib / aph(6)-Id - 1..90740 90740
- inside IScluster/Tn blaOXA-58 / mph(E) / msr(E) / aac(3)-IId - 13286..30726 17440


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, RelE/ParE toxin family

(8-84)

Antitoxin

RelB antitoxin/Antitoxin DinJ

(1-72)


Sequences

Toxin        


Download         Length: 98 a.a.        Molecular weight: 11292.52 Da        Isoelectric Point: 10.4753

>T254505 WP_000221358.1 NZ_CP102936:21251-21544 [Acinetobacter sp. AOR07_HL]
MTYKLLRHKDFTAEWEKLPVAIRDQFKKKLAKVIEQPHIPKNMLRGDLAGCYKIKLLKAGVRLVYQVKDDQVVILLITVG
KRADSIVYDEAKKRIKD

Download         Length: 294 bp

Antitoxin


Download         Length: 82 a.a.        Molecular weight: 9249.64 Da        Isoelectric Point: 4.3142

>AT254505 WP_000246755.1 NZ_CP102936:21016-21261 [Acinetobacter sp. AOR07_HL]
MATVNFRIDEALKEKSYSILKEQGIAPTDFFTSILEYVATTGKLPVKKALLSEEDEELLALVRKRINDPKEMFEEVTLDD
L

Download         Length: 246 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A6A1RKP4

Antitoxin

Source ID Structure
AlphaFold DB A0A6A1RJ80

References