Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | PumAB/upstrm_HI1419-dnstrm_HI1420 |
Location | 30327..30911 | Replicon | plasmid unnamed1 |
Accession | NZ_CP102935 | ||
Organism | Acinetobacter sp. AOR07_HL |
Toxin (Protein)
Gene name | PumA | Uniprot ID | N9JY46 |
Locus tag | MKL45_RS18340 | Protein ID | WP_000286963.1 |
Coordinates | 30609..30911 (-) | Length | 101 a.a. |
Antitoxin (Protein)
Gene name | PumB | Uniprot ID | - |
Locus tag | MKL45_RS18335 | Protein ID | WP_000985610.1 |
Coordinates | 30327..30608 (-) | Length | 94 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
MKL45_RS18295 (MKL45_18300) | 25560..25772 | + | 213 | WP_016653394.1 | hypothetical protein | - |
MKL45_RS18300 (MKL45_18305) | 25897..26106 | - | 210 | WP_000069471.1 | hypothetical protein | - |
MKL45_RS18305 (MKL45_18310) | 26099..26401 | - | 303 | WP_001140619.1 | XRE family transcriptional regulator | - |
MKL45_RS18310 (MKL45_18315) | 26394..26750 | - | 357 | WP_000269903.1 | type II toxin-antitoxin system RelE/ParE family toxin | - |
MKL45_RS18315 (MKL45_18320) | 27458..27994 | + | 537 | WP_009501148.1 | porin family protein | - |
MKL45_RS18320 (MKL45_18325) | 28164..28394 | - | 231 | WP_009501150.1 | hypothetical protein | - |
MKL45_RS18325 (MKL45_18330) | 28731..29102 | + | 372 | WP_009501156.1 | RcnB family protein | - |
MKL45_RS18330 (MKL45_18335) | 29166..30099 | - | 934 | Protein_36 | IS5-like element ISAba13 family transposase | - |
MKL45_RS18335 (MKL45_18340) | 30327..30608 | - | 282 | WP_000985610.1 | putative addiction module antidote protein | Antitoxin |
MKL45_RS18340 (MKL45_18345) | 30609..30911 | - | 303 | WP_000286963.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
MKL45_RS18345 (MKL45_18350) | 31073..31612 | - | 540 | WP_002055813.1 | hypothetical protein | - |
MKL45_RS18350 (MKL45_18355) | 31842..33064 | + | 1223 | Protein_40 | IS256 family transposase | - |
MKL45_RS18355 (MKL45_18360) | 33107..35773 | + | 2667 | WP_109850699.1 | excinuclease ABC subunit UvrA | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Non-Mobilizable plasmid | - | - | 1..133577 | 133577 | |
- | inside | IScluster/Tn | - | - | 24319..43036 | 18717 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 101 a.a. Molecular weight: 11545.02 Da Isoelectric Point: 4.6838
>T254504 WP_000286963.1 NZ_CP102935:c30911-30609 [Acinetobacter sp. AOR07_HL]
MYSIYTTEAFDDWFTKLKDQQAKRRIQVRIDRVEDGNFGDTEPVGEGVSELRFFFGPGYRIYYCKQGQRVVILLAGGDKS
TQSKDIKLALQLAQDLEEEL
MYSIYTTEAFDDWFTKLKDQQAKRRIQVRIDRVEDGNFGDTEPVGEGVSELRFFFGPGYRIYYCKQGQRVVILLAGGDKS
TQSKDIKLALQLAQDLEEEL
Download Length: 303 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|