Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | IV | Classification (family/domain) | cptAB/- |
Location | 3333757..3334410 | Replicon | chromosome |
Accession | NZ_CP102934 | ||
Organism | Acinetobacter sp. AOR07_HL |
Toxin (Protein)
Gene name | cptA | Uniprot ID | A0A9E9PBS3 |
Locus tag | MKL45_RS15740 | Protein ID | WP_002096593.1 |
Coordinates | 3333757..3334146 (-) | Length | 130 a.a. |
Antitoxin (Protein)
Gene name | cptB | Uniprot ID | V5V966 |
Locus tag | MKL45_RS15745 | Protein ID | WP_001288210.1 |
Coordinates | 3334153..3334410 (-) | Length | 86 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
MKL45_RS15725 (MKL45_15730) | 3328875..3331070 | - | 2196 | WP_001158905.1 | TRAP transporter large permease subunit | - |
MKL45_RS15730 (MKL45_15735) | 3331258..3331824 | - | 567 | WP_000651536.1 | rhombosortase | - |
MKL45_RS15735 (MKL45_15740) | 3331902..3332987 | - | 1086 | WP_000049106.1 | hypothetical protein | - |
MKL45_RS15740 (MKL45_15745) | 3333757..3334146 | - | 390 | WP_002096593.1 | hypothetical protein | Toxin |
MKL45_RS15745 (MKL45_15750) | 3334153..3334410 | - | 258 | WP_001288210.1 | succinate dehydrogenase assembly factor 2 | Antitoxin |
MKL45_RS15750 (MKL45_15755) | 3334598..3335770 | + | 1173 | WP_001190548.1 | acyl-CoA dehydrogenase family protein | - |
MKL45_RS15755 (MKL45_15760) | 3335819..3337309 | - | 1491 | WP_004745487.1 | NAD(P)/FAD-dependent oxidoreductase | - |
MKL45_RS15760 (MKL45_15765) | 3337491..3337868 | - | 378 | WP_001216380.1 | 50S ribosomal protein L17 | - |
MKL45_RS15765 (MKL45_15770) | 3337887..3338894 | - | 1008 | WP_000198631.1 | DNA-directed RNA polymerase subunit alpha | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 130 a.a. Molecular weight: 15677.99 Da Isoelectric Point: 10.3890
>T254502 WP_002096593.1 NZ_CP102934:c3334146-3333757 [Acinetobacter sp. AOR07_HL]
MINHLNFKLKYSRFSIIFQFFIGLSLAILFYQLMPLLWWLVVISLLFISFIFFLKRPQLAQIAYLDKKLWSLAYHSQNTI
SRVKILKIIDYQIFIVIYFEGHKTLTSIIWFDQMSLVEWKKLKTLEKLY
MINHLNFKLKYSRFSIIFQFFIGLSLAILFYQLMPLLWWLVVISLLFISFIFFLKRPQLAQIAYLDKKLWSLAYHSQNTI
SRVKILKIIDYQIFIVIYFEGHKTLTSIIWFDQMSLVEWKKLKTLEKLY
Download Length: 390 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|