Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/LOTUS_5_Limkain_b1-RHH |
Location | 4554024..4554640 | Replicon | chromosome |
Accession | NZ_CP102932 | ||
Organism | Enterobacter sp. Crenshaw |
Toxin (Protein)
Gene name | vapC | Uniprot ID | - |
Locus tag | NWV12_RS21710 | Protein ID | WP_080298642.1 |
Coordinates | 4554024..4554395 (-) | Length | 124 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | A0A808IJD0 |
Locus tag | NWV12_RS21715 | Protein ID | WP_023309753.1 |
Coordinates | 4554398..4554640 (-) | Length | 81 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NWV12_RS21695 (NWV12_21695) | 4551524..4552426 | + | 903 | WP_008501831.1 | formate dehydrogenase subunit beta | - |
NWV12_RS21700 (NWV12_21700) | 4552423..4553058 | + | 636 | WP_010436852.1 | formate dehydrogenase cytochrome b556 subunit | - |
NWV12_RS21705 (NWV12_21705) | 4553055..4553984 | + | 930 | WP_029741588.1 | formate dehydrogenase accessory protein FdhE | - |
NWV12_RS21710 (NWV12_21710) | 4554024..4554395 | - | 372 | WP_080298642.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
NWV12_RS21715 (NWV12_21715) | 4554398..4554640 | - | 243 | WP_023309753.1 | ribbon-helix-helix protein, CopG family | Antitoxin |
NWV12_RS21720 (NWV12_21720) | 4554840..4555760 | + | 921 | WP_048981029.1 | alpha/beta hydrolase | - |
NWV12_RS21725 (NWV12_21725) | 4555769..4556710 | - | 942 | WP_039264191.1 | fatty acid biosynthesis protein FabY | - |
NWV12_RS21730 (NWV12_21730) | 4556755..4557192 | - | 438 | WP_008501836.1 | D-aminoacyl-tRNA deacylase | - |
NWV12_RS21735 (NWV12_21735) | 4557189..4558070 | - | 882 | WP_033146965.1 | virulence factor BrkB family protein | - |
NWV12_RS21740 (NWV12_21740) | 4558064..4558663 | - | 600 | WP_039264189.1 | glucose-1-phosphatase | - |
NWV12_RS21745 (NWV12_21745) | 4558752..4559222 | - | 471 | WP_033146967.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 124 a.a. Molecular weight: 13688.85 Da Isoelectric Point: 6.9789
>T254498 WP_080298642.1 NZ_CP102932:c4554395-4554024 [Enterobacter sp. Crenshaw]
MEHMAVFDTNILIDLFNNRVEAADAIDRTASHRAISLITWMEVMVGARKHGHEAKTATVMGVFEIIDITRDIAERSVILR
EKHGMKLPDAIILATAQSRNCPLISRNTKDFSGITGVVSPYQL
MEHMAVFDTNILIDLFNNRVEAADAIDRTASHRAISLITWMEVMVGARKHGHEAKTATVMGVFEIIDITRDIAERSVILR
EKHGMKLPDAIILATAQSRNCPLISRNTKDFSGITGVVSPYQL
Download Length: 372 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|