Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | IV | Classification (family/domain) | cptAB/Cpta(toxin) |
Location | 3836508..3837165 | Replicon | chromosome |
Accession | NZ_CP102932 | ||
Organism | Enterobacter sp. Crenshaw |
Toxin (Protein)
Gene name | cptA | Uniprot ID | - |
Locus tag | NWV12_RS18170 | Protein ID | WP_101744679.1 |
Coordinates | 3836508..3836918 (-) | Length | 137 a.a. |
Antitoxin (Protein)
Gene name | cptB | Uniprot ID | V3PWU7 |
Locus tag | NWV12_RS18175 | Protein ID | WP_010435322.1 |
Coordinates | 3836899..3837165 (-) | Length | 89 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NWV12_RS18150 (NWV12_18150) | 3832501..3834234 | - | 1734 | WP_039262981.1 | single-stranded-DNA-specific exonuclease RecJ | - |
NWV12_RS18155 (NWV12_18155) | 3834240..3834953 | - | 714 | WP_047060452.1 | bifunctional protein-disulfide isomerase/oxidoreductase DsbC | - |
NWV12_RS18160 (NWV12_18160) | 3834982..3835878 | - | 897 | WP_023309098.1 | site-specific tyrosine recombinase XerD | - |
NWV12_RS18165 (NWV12_18165) | 3835980..3836501 | + | 522 | WP_039262979.1 | flavodoxin FldB | - |
NWV12_RS18170 (NWV12_18170) | 3836508..3836918 | - | 411 | WP_101744679.1 | protein YgfX | Toxin |
NWV12_RS18175 (NWV12_18175) | 3836899..3837165 | - | 267 | WP_010435322.1 | FAD assembly factor SdhE | Antitoxin |
NWV12_RS18180 (NWV12_18180) | 3837460..3838440 | + | 981 | WP_029739202.1 | tRNA-modifying protein YgfZ | - |
NWV12_RS18185 (NWV12_18185) | 3838515..3839174 | - | 660 | WP_033146591.1 | hemolysin III family protein | - |
NWV12_RS18190 (NWV12_18190) | 3839340..3839651 | - | 312 | WP_048980550.1 | N(4)-acetylcytidine aminohydrolase | - |
NWV12_RS18195 (NWV12_18195) | 3839703..3840434 | + | 732 | WP_032660101.1 | MurR/RpiR family transcriptional regulator | - |
NWV12_RS18200 (NWV12_18200) | 3840551..3841984 | + | 1434 | WP_048980547.1 | 6-phospho-beta-glucosidase BglA | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 137 a.a. Molecular weight: 16071.00 Da Isoelectric Point: 10.9468
>T254497 WP_101744679.1 NZ_CP102932:c3836918-3836508 [Enterobacter sp. Crenshaw]
VVLWQSDLRVSWRSQWMSLLLHGLVAAFVLLMPWPLSYTPLWLLLLSFVVFDSVRSQRRINARQGEIKLLMDSRLRWQGK
EWDILGMPWMLNCGMMLRLRKVDGGRCQHLWLAADSMDAAEWRDLRRMLSQQTTQG
VVLWQSDLRVSWRSQWMSLLLHGLVAAFVLLMPWPLSYTPLWLLLLSFVVFDSVRSQRRINARQGEIKLLMDSRLRWQGK
EWDILGMPWMLNCGMMLRLRKVDGGRCQHLWLAADSMDAAEWRDLRRMLSQQTTQG
Download Length: 411 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|