Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | ataRT/DUF1778(antitoxin) |
| Location | 1639176..1639973 | Replicon | chromosome |
| Accession | NZ_CP102932 | ||
| Organism | Enterobacter sp. Crenshaw | ||
Toxin (Protein)
| Gene name | ataT | Uniprot ID | A0A808IDQ0 |
| Locus tag | NWV12_RS07685 | Protein ID | WP_048979073.1 |
| Coordinates | 1639452..1639973 (+) | Length | 174 a.a. |
Antitoxin (Protein)
| Gene name | ataR | Uniprot ID | - |
| Locus tag | NWV12_RS07680 | Protein ID | WP_023311079.1 |
| Coordinates | 1639176..1639445 (+) | Length | 90 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NWV12_RS07650 (NWV12_07650) | 1634803..1635246 | - | 444 | WP_032658095.1 | helix-turn-helix domain-containing protein | - |
| NWV12_RS07655 (NWV12_07655) | 1635399..1636640 | + | 1242 | WP_048979071.1 | bifunctional glucose-1-phosphatase/inositol phosphatase | - |
| NWV12_RS07660 (NWV12_07660) | 1636674..1636901 | - | 228 | WP_008499832.1 | YccJ family protein | - |
| NWV12_RS07665 (NWV12_07665) | 1636922..1637518 | - | 597 | WP_023311076.1 | NAD(P)H:quinone oxidoreductase | - |
| NWV12_RS07670 (NWV12_07670) | 1637909..1638079 | + | 171 | WP_023311077.1 | general stress protein | - |
| NWV12_RS07675 (NWV12_07675) | 1638197..1639114 | + | 918 | WP_048979072.1 | DMT family transporter | - |
| NWV12_RS07680 (NWV12_07680) | 1639176..1639445 | + | 270 | WP_023311079.1 | DUF1778 domain-containing protein | Antitoxin |
| NWV12_RS07685 (NWV12_07685) | 1639452..1639973 | + | 522 | WP_048979073.1 | GNAT family N-acetyltransferase | Toxin |
| NWV12_RS07690 (NWV12_07690) | 1640047..1641369 | - | 1323 | WP_048979074.1 | pyrimidine utilization transport protein G | - |
| NWV12_RS07695 (NWV12_07695) | 1641391..1641885 | - | 495 | WP_048979075.1 | pyrimidine utilization flavin reductase protein F | - |
| NWV12_RS07700 (NWV12_07700) | 1641895..1642485 | - | 591 | WP_033145164.1 | malonic semialdehyde reductase | - |
| NWV12_RS07705 (NWV12_07705) | 1642495..1643295 | - | 801 | WP_048979076.1 | pyrimidine utilization protein D | - |
| NWV12_RS07710 (NWV12_07710) | 1643303..1643689 | - | 387 | WP_010429508.1 | pyrimidine utilization protein C | - |
| NWV12_RS07715 (NWV12_07715) | 1643701..1644390 | - | 690 | WP_033145167.1 | pyrimidine utilization protein B | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 174 a.a. Molecular weight: 19817.63 Da Isoelectric Point: 6.9695
>T254490 WP_048979073.1 NZ_CP102932:1639452-1639973 [Enterobacter sp. Crenshaw]
VENLTIEMLSEGTDYDFEYFDCGEPSLNAFLAEHLVRQHNGRILRAYLLKERDRPRVLGYYTLSGSCFERAMLPSKTQQR
RIPYINVPSVTLGRLAVDKTLQGNEWGTTLVAHAMRVVYLASQAVGVHGIFVDALDERAKRFYLKQGFIPLTAENSHSLF
FPTKSIERLFEQE
VENLTIEMLSEGTDYDFEYFDCGEPSLNAFLAEHLVRQHNGRILRAYLLKERDRPRVLGYYTLSGSCFERAMLPSKTQQR
RIPYINVPSVTLGRLAVDKTLQGNEWGTTLVAHAMRVVYLASQAVGVHGIFVDALDERAKRFYLKQGFIPLTAENSHSLF
FPTKSIERLFEQE
Download Length: 522 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|