Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | shpAB/BrnT-BrnA |
| Location | 577663..578239 | Replicon | chromosome |
| Accession | NZ_CP102932 | ||
| Organism | Enterobacter sp. Crenshaw | ||
Toxin (Protein)
| Gene name | shpA | Uniprot ID | A0A808IJQ6 |
| Locus tag | NWV12_RS02675 | Protein ID | WP_048980720.1 |
| Coordinates | 577663..577950 (+) | Length | 96 a.a. |
Antitoxin (Protein)
| Gene name | shpB | Uniprot ID | A0A808I9W7 |
| Locus tag | NWV12_RS02680 | Protein ID | WP_048980603.1 |
| Coordinates | 577937..578239 (+) | Length | 101 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NWV12_RS02650 (NWV12_02650) | 572764..573459 | + | 696 | WP_048980606.1 | winged helix-turn-helix domain-containing protein | - |
| NWV12_RS02655 (NWV12_02655) | 573609..574079 | + | 471 | WP_033144545.1 | MarR family transcriptional regulator | - |
| NWV12_RS02660 (NWV12_02660) | 574076..575143 | + | 1068 | WP_101744430.1 | HlyD family secretion protein | - |
| NWV12_RS02665 (NWV12_02665) | 575148..576224 | + | 1077 | WP_023310256.1 | DUF2955 domain-containing protein | - |
| NWV12_RS02670 (NWV12_02670) | 576221..577492 | - | 1272 | WP_048980604.1 | DUF445 domain-containing protein | - |
| NWV12_RS02675 (NWV12_02675) | 577663..577950 | + | 288 | WP_048980720.1 | BrnT family toxin | Toxin |
| NWV12_RS02680 (NWV12_02680) | 577937..578239 | + | 303 | WP_048980603.1 | BrnA antitoxin family protein | Antitoxin |
| NWV12_RS02685 (NWV12_02685) | 578270..578908 | - | 639 | WP_048980602.1 | LysE family translocator | - |
| NWV12_RS02690 (NWV12_02690) | 578956..579699 | - | 744 | WP_048980600.1 | AraC family transcriptional regulator | - |
| NWV12_RS02695 (NWV12_02695) | 579851..581221 | + | 1371 | WP_048980598.1 | NAD-dependent succinate-semialdehyde dehydrogenase | - |
| NWV12_RS02700 (NWV12_02700) | 581267..581587 | - | 321 | WP_039262264.1 | hypothetical protein | - |
| NWV12_RS02705 (NWV12_02705) | 581587..582132 | - | 546 | WP_023310269.1 | YfaZ family outer membrane protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 96 a.a. Molecular weight: 11201.66 Da Isoelectric Point: 6.7609
>T254488 WP_048980720.1 NZ_CP102932:577663-577950 [Enterobacter sp. Crenshaw]
MPTEFEWDTNKAKSNLIKHGIRFEEAVLVFDDPYHLSLQDRHENGEFRWQTIGLVHGLIVIMVAHTVRFESGDEVIRIIS
ARKADRKERNRYEHG
MPTEFEWDTNKAKSNLIKHGIRFEEAVLVFDDPYHLSLQDRHENGEFRWQTIGLVHGLIVIMVAHTVRFESGDEVIRIIS
ARKADRKERNRYEHG
Download Length: 288 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A808IJQ6 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A808I9W7 |