Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | relBE/ParE-RelB |
Location | 3973769..3974285 | Replicon | chromosome |
Accession | NZ_CP102929 | ||
Organism | Pseudomonas sp. CBS |
Toxin (Protein)
Gene name | relE | Uniprot ID | - |
Locus tag | NVB75_RS18250 | Protein ID | WP_258342669.1 |
Coordinates | 3973769..3974056 (-) | Length | 96 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | - |
Locus tag | NVB75_RS18255 | Protein ID | WP_258348672.1 |
Coordinates | 3974046..3974285 (-) | Length | 80 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NVB75_RS18230 (NVB75_18230) | 3969353..3970300 | - | 948 | WP_177020250.1 | FecR family protein | - |
NVB75_RS18235 (NVB75_18235) | 3970297..3970830 | - | 534 | WP_177020251.1 | RNA polymerase sigma factor | - |
NVB75_RS18240 (NVB75_18240) | 3971042..3972100 | - | 1059 | WP_256344485.1 | haloacid dehalogenase-like hydrolase | - |
NVB75_RS18245 (NVB75_18245) | 3972342..3973733 | + | 1392 | WP_258342668.1 | L-cystine transporter | - |
NVB75_RS18250 (NVB75_18250) | 3973769..3974056 | - | 288 | WP_258342669.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
NVB75_RS18255 (NVB75_18255) | 3974046..3974285 | - | 240 | WP_258348672.1 | type II toxin-antitoxin system RelB/DinJ family antitoxin | Antitoxin |
NVB75_RS18260 (NVB75_18260) | 3974369..3974881 | - | 513 | WP_008438965.1 | dihydrofolate reductase | - |
NVB75_RS18265 (NVB75_18265) | 3974972..3976351 | + | 1380 | WP_258342670.1 | DUF2868 domain-containing protein | - |
NVB75_RS18270 (NVB75_18270) | 3976344..3977717 | + | 1374 | WP_258342671.1 | DUF3482 domain-containing protein | - |
NVB75_RS18275 (NVB75_18275) | 3977714..3978268 | - | 555 | WP_258342672.1 | HD domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 96 a.a. Molecular weight: 11365.24 Da Isoelectric Point: 10.0977
>T254484 WP_258342669.1 NZ_CP102929:c3974056-3973769 [Pseudomonas sp. CBS]
MTYNLEFDARALKEWRKLGDTVRQQLKKKLVEILTHPRIEANRLHGLPDCYKIKLRSSGYRLVYQVIDQEVMVFVVAVDK
RERDEVYRKATERLS
MTYNLEFDARALKEWRKLGDTVRQQLKKKLVEILTHPRIEANRLHGLPDCYKIKLRSSGYRLVYQVIDQEVMVFVVAVDK
RERDEVYRKATERLS
Download Length: 288 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|