Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | hicAB/HicA-HicB |
| Location | 2439743..2440357 | Replicon | chromosome |
| Accession | NZ_CP102929 | ||
| Organism | Pseudomonas sp. CBS | ||
Toxin (Protein)
| Gene name | hicA | Uniprot ID | A0A1R0GDL0 |
| Locus tag | NVB75_RS10765 | Protein ID | WP_026077965.1 |
| Coordinates | 2440169..2440357 (-) | Length | 63 a.a. |
Antitoxin (Protein)
| Gene name | hicB | Uniprot ID | - |
| Locus tag | NVB75_RS10760 | Protein ID | WP_258347129.1 |
| Coordinates | 2439743..2440147 (-) | Length | 135 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NVB75_RS10735 (NVB75_10735) | 2434757..2435629 | + | 873 | WP_258347125.1 | urea transporter | - |
| NVB75_RS10740 (NVB75_10740) | 2435661..2436485 | + | 825 | WP_258347126.1 | ion transporter | - |
| NVB75_RS10745 (NVB75_10745) | 2436591..2437595 | + | 1005 | WP_258347127.1 | sulfate ABC transporter substrate-binding protein | - |
| NVB75_RS10750 (NVB75_10750) | 2437753..2438367 | - | 615 | WP_258347128.1 | DUF5666 domain-containing protein | - |
| NVB75_RS10755 (NVB75_10755) | 2438546..2439742 | + | 1197 | WP_167663625.1 | MFS transporter | - |
| NVB75_RS10760 (NVB75_10760) | 2439743..2440147 | - | 405 | WP_258347129.1 | type II toxin-antitoxin system HicB family antitoxin | Antitoxin |
| NVB75_RS10765 (NVB75_10765) | 2440169..2440357 | - | 189 | WP_026077965.1 | type II toxin-antitoxin system HicA family toxin | Toxin |
| NVB75_RS10770 (NVB75_10770) | 2440573..2441451 | + | 879 | WP_258347130.1 | LysR family transcriptional regulator | - |
| NVB75_RS10775 (NVB75_10775) | 2441534..2443018 | - | 1485 | WP_258347131.1 | M10 family metallopeptidase C-terminal domain-containing protein | - |
| NVB75_RS10780 (NVB75_10780) | 2443365..2444114 | - | 750 | WP_258347132.1 | phosphonate metabolism protein PhnP | - |
| NVB75_RS10785 (NVB75_10785) | 2444105..2444668 | - | 564 | WP_258347133.1 | phosphonate metabolism protein/1,5-bisphosphokinase (PRPP-forming) PhnN | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 63 a.a. Molecular weight: 7196.40 Da Isoelectric Point: 11.2000
>T254483 WP_026077965.1 NZ_CP102929:c2440357-2440169 [Pseudomonas sp. CBS]
VQSRLLIKELQEAGWVLDRVTGSHHLFTHRYNPYTIPVPHPKKDLPMGTVRSIRKRAGLFSF
VQSRLLIKELQEAGWVLDRVTGSHHLFTHRYNPYTIPVPHPKKDLPMGTVRSIRKRAGLFSF
Download Length: 189 bp
Antitoxin
Download Length: 135 a.a. Molecular weight: 14776.83 Da Isoelectric Point: 4.5011
>AT254483 WP_258347129.1 NZ_CP102929:c2440147-2439743 [Pseudomonas sp. CBS]
MQYPICIEWGDDFVATGIQIPDIPGAVTAGDSFEEAYNAAVEVAHIMLQEIAAEGRAIPMPTSVAAHHDNEDYAGMGWGM
LELDISPYLGKTEKVNVTLPGYVIQRIDRYVREHKVKSRSSFLADAALEKLVRL
MQYPICIEWGDDFVATGIQIPDIPGAVTAGDSFEEAYNAAVEVAHIMLQEIAAEGRAIPMPTSVAAHHDNEDYAGMGWGM
LELDISPYLGKTEKVNVTLPGYVIQRIDRYVREHKVKSRSSFLADAALEKLVRL
Download Length: 405 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|