Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vagCD/VapC-VagC |
| Location | 117476..118128 | Replicon | plasmid pK18-45_P1 |
| Accession | NZ_CP102922 | ||
| Organism | Klebsiella quasipneumoniae strain K18-45 | ||
Toxin (Protein)
| Gene name | vagD | Uniprot ID | A0A8A2Q2K1 |
| Locus tag | NWF33_RS25945 | Protein ID | WP_017901321.1 |
| Coordinates | 117476..117901 (-) | Length | 142 a.a. |
Antitoxin (Protein)
| Gene name | vagC | Uniprot ID | A0A853H7M9 |
| Locus tag | NWF33_RS25950 | Protein ID | WP_001261275.1 |
| Coordinates | 117898..118128 (-) | Length | 77 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NWF33_RS25910 (NWF33_25910) | 113185..113301 | + | 117 | Protein_121 | transposase | - |
| NWF33_RS25915 (NWF33_25915) | 113426..113596 | - | 171 | Protein_122 | LysR family transcriptional regulator | - |
| NWF33_RS25920 (NWF33_25920) | 113607..113834 | + | 228 | Protein_123 | IS3 family transposase | - |
| NWF33_RS25925 (NWF33_25925) | 113926..115482 | - | 1557 | WP_227639744.1 | sensor domain-containing diguanylate cyclase | - |
| NWF33_RS25930 (NWF33_25930) | 115669..115842 | - | 174 | Protein_125 | nuclease | - |
| NWF33_RS25935 (NWF33_25935) | 115895..116431 | - | 537 | Protein_126 | integrase core domain-containing protein | - |
| NWF33_RS25940 (NWF33_25940) | 116490..117458 | - | 969 | WP_077254762.1 | IS5 family transposase | - |
| NWF33_RS25945 (NWF33_25945) | 117476..117901 | - | 426 | WP_017901321.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
| NWF33_RS25950 (NWF33_25950) | 117898..118128 | - | 231 | WP_001261275.1 | type II toxin-antitoxin system VapB family antitoxin | Antitoxin |
| NWF33_RS25955 (NWF33_25955) | 118381..120957 | - | 2577 | WP_017901322.1 | nuclease domain-containing protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Non-Mobilizable plasmid | - | pla | 1..220751 | 220751 | |
| - | flank | IS/Tn | - | - | 116490..117458 | 968 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 142 a.a. Molecular weight: 15412.91 Da Isoelectric Point: 7.1364
>T254461 WP_017901321.1 NZ_CP102922:c117901-117476 [Klebsiella quasipneumoniae]
MKKTWMLDTNICSFIMREQPAAVLKRLEQVVLRGDRIVVSAVTYAEMRFGATGPKASPRHIQLVDAFCARLDAILPWDRA
AVDATTDIRVALRLAGTPIGPNDTAIAGHAIAAGAILVTNNTREFERVPGLVLEDWVGFVE
MKKTWMLDTNICSFIMREQPAAVLKRLEQVVLRGDRIVVSAVTYAEMRFGATGPKASPRHIQLVDAFCARLDAILPWDRA
AVDATTDIRVALRLAGTPIGPNDTAIAGHAIAAGAILVTNNTREFERVPGLVLEDWVGFVE
Download Length: 426 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A8A2Q2K1 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A853H7M9 |