Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | relBE/ParE-RelB |
Location | 4629697..4630210 | Replicon | chromosome |
Accession | NZ_CP102921 | ||
Organism | Klebsiella quasipneumoniae strain K18-45 |
Toxin (Protein)
Gene name | relE | Uniprot ID | A0A663BE04 |
Locus tag | NWF33_RS22640 | Protein ID | WP_017900571.1 |
Coordinates | 4629697..4629978 (-) | Length | 94 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | R4Y888 |
Locus tag | NWF33_RS22645 | Protein ID | WP_002886901.1 |
Coordinates | 4629968..4630210 (-) | Length | 81 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NWF33_RS22625 (4624739) | 4624739..4626394 | + | 1656 | WP_017900569.1 | alpha,alpha-phosphotrehalase | - |
NWF33_RS22630 (4626780) | 4626780..4628918 | + | 2139 | WP_004206513.1 | anaerobic ribonucleoside-triphosphate reductase | - |
NWF33_RS22635 (4629229) | 4629229..4629693 | + | 465 | WP_004206512.1 | anaerobic ribonucleoside-triphosphate reductase-activating protein | - |
NWF33_RS22640 (4629697) | 4629697..4629978 | - | 282 | WP_017900571.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
NWF33_RS22645 (4629968) | 4629968..4630210 | - | 243 | WP_002886901.1 | type II toxin-antitoxin system RelB/DinJ family antitoxin | Antitoxin |
NWF33_RS22650 (4630288) | 4630288..4632198 | - | 1911 | WP_017900572.1 | PRD domain-containing protein | - |
NWF33_RS22655 (4632221) | 4632221..4633372 | - | 1152 | WP_017900573.1 | lactonase family protein | - |
NWF33_RS22660 (4633440) | 4633440..4634180 | - | 741 | WP_017900574.1 | KDGP aldolase family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 94 a.a. Molecular weight: 11082.93 Da Isoelectric Point: 10.4123
>T254458 WP_017900571.1 NZ_CP102921:c4629978-4629697 [Klebsiella quasipneumoniae]
MTYELEFDPRAWREWQLGETVKKQFKNKLQQIVQNPRIESARLSDLPDCYKIKLKASGYRLVYQVRDRVVVVYVIAIGKR
EKAAVYHQANKRL
MTYELEFDPRAWREWQLGETVKKQFKNKLQQIVQNPRIESARLSDLPDCYKIKLKASGYRLVYQVRDRVVVVYVIAIGKR
EKAAVYHQANKRL
Download Length: 282 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A663BE04 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0H3GLP0 |