Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | Hha-TomB/- |
| Location | 3954019..3954638 | Replicon | chromosome |
| Accession | NZ_CP102921 | ||
| Organism | Klebsiella quasipneumoniae strain K18-45 | ||
Toxin (Protein)
| Gene name | Hha | Uniprot ID | R8WYV2 |
| Locus tag | NWF33_RS19415 | Protein ID | WP_002892050.1 |
| Coordinates | 3954420..3954638 (+) | Length | 73 a.a. |
Antitoxin (Protein)
| Gene name | TomB | Uniprot ID | J2DPF6 |
| Locus tag | NWF33_RS19410 | Protein ID | WP_002892066.1 |
| Coordinates | 3954019..3954393 (+) | Length | 125 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NWF33_RS19400 (3949172) | 3949172..3950365 | + | 1194 | WP_004204747.1 | multidrug efflux RND transporter periplasmic adaptor subunit AcrA | - |
| NWF33_RS19405 (3950388) | 3950388..3953534 | + | 3147 | WP_017898892.1 | multidrug efflux RND transporter permease subunit AcrB | - |
| NWF33_RS19410 (3954019) | 3954019..3954393 | + | 375 | WP_002892066.1 | Hha toxicity modulator TomB | Antitoxin |
| NWF33_RS19415 (3954420) | 3954420..3954638 | + | 219 | WP_002892050.1 | HHA domain-containing protein | Toxin |
| NWF33_RS19420 (3954797) | 3954797..3955363 | + | 567 | WP_004204750.1 | maltose O-acetyltransferase | - |
| NWF33_RS19425 (3955335) | 3955335..3955457 | - | 123 | WP_032426076.1 | hypothetical protein | - |
| NWF33_RS19430 (3955500) | 3955500..3955970 | + | 471 | WP_017898893.1 | YlaC family protein | - |
| NWF33_RS19435 (3955939) | 3955939..3957396 | - | 1458 | WP_017898894.1 | PLP-dependent aminotransferase family protein | - |
| NWF33_RS19440 (3957497) | 3957497..3958195 | + | 699 | WP_017898895.1 | GNAT family protein | - |
| NWF33_RS19445 (3958192) | 3958192..3958332 | - | 141 | WP_002892018.1 | type B 50S ribosomal protein L36 | - |
| NWF33_RS19450 (3958332) | 3958332..3958595 | - | 264 | WP_004204754.1 | type B 50S ribosomal protein L31 | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 73 a.a. Molecular weight: 8628.00 Da Isoelectric Point: 8.9008
>T254457 WP_002892050.1 NZ_CP102921:3954420-3954638 [Klebsiella quasipneumoniae]
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPTSVWKFIR
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPTSVWKFIR
Download Length: 219 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 14368.06 Da Isoelectric Point: 4.8989
>AT254457 WP_002892066.1 NZ_CP102921:3954019-3954393 [Klebsiella quasipneumoniae]
MDEYSPKRHDIAQLRFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYAEDNKLIAQVDEYL
DDTFTLFSNYGINSTDLQKWKKSGNRLFRCFVNASRENPASLSC
MDEYSPKRHDIAQLRFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYAEDNKLIAQVDEYL
DDTFTLFSNYGINSTDLQKWKKSGNRLFRCFVNASRENPASLSC
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A2P8K6F2 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0H3GJ93 |