Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) Hha-TomB/-
Location 3954019..3954638 Replicon chromosome
Accession NZ_CP102921
Organism Klebsiella quasipneumoniae strain K18-45

Toxin (Protein)


Gene name Hha Uniprot ID R8WYV2
Locus tag NWF33_RS19415 Protein ID WP_002892050.1
Coordinates 3954420..3954638 (+) Length 73 a.a.

Antitoxin (Protein)


Gene name TomB Uniprot ID J2DPF6
Locus tag NWF33_RS19410 Protein ID WP_002892066.1
Coordinates 3954019..3954393 (+) Length 125 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NWF33_RS19400 (3949172) 3949172..3950365 + 1194 WP_004204747.1 multidrug efflux RND transporter periplasmic adaptor subunit AcrA -
NWF33_RS19405 (3950388) 3950388..3953534 + 3147 WP_017898892.1 multidrug efflux RND transporter permease subunit AcrB -
NWF33_RS19410 (3954019) 3954019..3954393 + 375 WP_002892066.1 Hha toxicity modulator TomB Antitoxin
NWF33_RS19415 (3954420) 3954420..3954638 + 219 WP_002892050.1 HHA domain-containing protein Toxin
NWF33_RS19420 (3954797) 3954797..3955363 + 567 WP_004204750.1 maltose O-acetyltransferase -
NWF33_RS19425 (3955335) 3955335..3955457 - 123 WP_032426076.1 hypothetical protein -
NWF33_RS19430 (3955500) 3955500..3955970 + 471 WP_017898893.1 YlaC family protein -
NWF33_RS19435 (3955939) 3955939..3957396 - 1458 WP_017898894.1 PLP-dependent aminotransferase family protein -
NWF33_RS19440 (3957497) 3957497..3958195 + 699 WP_017898895.1 GNAT family protein -
NWF33_RS19445 (3958192) 3958192..3958332 - 141 WP_002892018.1 type B 50S ribosomal protein L36 -
NWF33_RS19450 (3958332) 3958332..3958595 - 264 WP_004204754.1 type B 50S ribosomal protein L31 -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Haemolysin expression modulating, HHA

(13-69)

Antitoxin

Biofilm formation regulator YbaJ

(1-116)


Sequences

Toxin        


Download         Length: 73 a.a.        Molecular weight: 8628.00 Da        Isoelectric Point: 8.9008

>T254457 WP_002892050.1 NZ_CP102921:3954420-3954638 [Klebsiella quasipneumoniae]
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPTSVWKFIR

Download         Length: 219 bp

Antitoxin


Download         Length: 125 a.a.        Molecular weight: 14368.06 Da        Isoelectric Point: 4.8989

>AT254457 WP_002892066.1 NZ_CP102921:3954019-3954393 [Klebsiella quasipneumoniae]
MDEYSPKRHDIAQLRFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYAEDNKLIAQVDEYL
DDTFTLFSNYGINSTDLQKWKKSGNRLFRCFVNASRENPASLSC

Download         Length: 375 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A2P8K6F2

Antitoxin

Source ID Structure
AlphaFold DB A0A0H3GJ93

References