Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | cptAB/Cpta(toxin) |
| Location | 811629..812286 | Replicon | chromosome |
| Accession | NZ_CP102921 | ||
| Organism | Klebsiella quasipneumoniae strain K18-45 | ||
Toxin (Protein)
| Gene name | cptA | Uniprot ID | A0A2A5MNX1 |
| Locus tag | NWF33_RS03995 | Protein ID | WP_004205323.1 |
| Coordinates | 811876..812286 (+) | Length | 137 a.a. |
Antitoxin (Protein)
| Gene name | cptB | Uniprot ID | W8UQ37 |
| Locus tag | NWF33_RS03990 | Protein ID | WP_002916312.1 |
| Coordinates | 811629..811895 (+) | Length | 89 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NWF33_RS03965 (806838) | 806838..808271 | - | 1434 | WP_004205314.1 | 6-phospho-beta-glucosidase BglA | - |
| NWF33_RS03970 (808390) | 808390..809118 | - | 729 | WP_004205316.1 | MurR/RpiR family transcriptional regulator | - |
| NWF33_RS03975 (809168) | 809168..809479 | + | 312 | WP_004205318.1 | N(4)-acetylcytidine aminohydrolase | - |
| NWF33_RS03980 (809642) | 809642..810301 | + | 660 | WP_004205319.1 | hemolysin III family protein | - |
| NWF33_RS03985 (810400) | 810400..811383 | - | 984 | WP_017899798.1 | tRNA-modifying protein YgfZ | - |
| NWF33_RS03990 (811629) | 811629..811895 | + | 267 | WP_002916312.1 | FAD assembly factor SdhE | Antitoxin |
| NWF33_RS03995 (811876) | 811876..812286 | + | 411 | WP_004205323.1 | protein YgfX | Toxin |
| NWF33_RS04000 (812293) | 812293..812814 | - | 522 | WP_004205324.1 | flavodoxin FldB | - |
| NWF33_RS04005 (812915) | 812915..813811 | + | 897 | WP_004144729.1 | site-specific tyrosine recombinase XerD | - |
| NWF33_RS04010 (813834) | 813834..814547 | + | 714 | WP_002916301.1 | bifunctional protein-disulfide isomerase/oxidoreductase DsbC | - |
| NWF33_RS04015 (814553) | 814553..816286 | + | 1734 | WP_017899799.1 | single-stranded-DNA-specific exonuclease RecJ | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 137 a.a. Molecular weight: 16035.83 Da Isoelectric Point: 11.4778
>T254450 WP_004205323.1 NZ_CP102921:811876-812286 [Klebsiella quasipneumoniae]
VVLWQSDLRISWRAQWFSLLLHGVVAALVLLVPWPLSYTPIWLLLLSLVVFDCVRSQRRIHARRGEIKLLTDSRLRWQNA
DWEILGTPWVINSGMLLRLRHVDTRRGQHLWLAADSMDAGEWRDLRRLVLQKPAQE
VVLWQSDLRISWRAQWFSLLLHGVVAALVLLVPWPLSYTPIWLLLLSLVVFDCVRSQRRIHARRGEIKLLTDSRLRWQNA
DWEILGTPWVINSGMLLRLRHVDTRRGQHLWLAADSMDAGEWRDLRRLVLQKPAQE
Download Length: 411 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A2A5MNX1 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0H3GY41 |