Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) Hha-TomB/-
Location 3996631..3997250 Replicon chromosome
Accession NZ_CP102903
Organism Klebsiella quasipneumoniae strain KW4

Toxin (Protein)


Gene name Hha Uniprot ID R8WYV2
Locus tag NWT71_RS19580 Protein ID WP_002892050.1
Coordinates 3997032..3997250 (+) Length 73 a.a.

Antitoxin (Protein)


Gene name TomB Uniprot ID J2DPF6
Locus tag NWT71_RS19575 Protein ID WP_002892066.1
Coordinates 3996631..3997005 (+) Length 125 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NWT71_RS19565 (3991785) 3991785..3992978 + 1194 WP_023288645.1 multidrug efflux RND transporter periplasmic adaptor subunit AcrA -
NWT71_RS19570 (3993001) 3993001..3996147 + 3147 WP_065882810.1 multidrug efflux RND transporter permease subunit AcrB -
NWT71_RS19575 (3996631) 3996631..3997005 + 375 WP_002892066.1 Hha toxicity modulator TomB Antitoxin
NWT71_RS19580 (3997032) 3997032..3997250 + 219 WP_002892050.1 HHA domain-containing protein Toxin
NWT71_RS19585 (3997409) 3997409..3997975 + 567 WP_023288643.1 maltose O-acetyltransferase -
NWT71_RS19590 (3997947) 3997947..3998078 - 132 WP_032428629.1 hypothetical protein -
NWT71_RS19595 (3998112) 3998112..3998582 + 471 WP_023288642.1 YlaC family protein -
NWT71_RS19600 (3998551) 3998551..4000008 - 1458 WP_065882811.1 PLP-dependent aminotransferase family protein -
NWT71_RS19605 (4000109) 4000109..4000807 + 699 WP_065882812.1 GNAT family protein -
NWT71_RS19610 (4000804) 4000804..4000944 - 141 WP_002892018.1 type B 50S ribosomal protein L36 -
NWT71_RS19615 (4000944) 4000944..4001207 - 264 WP_004204754.1 type B 50S ribosomal protein L31 -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Haemolysin expression modulating, HHA

(13-69)

Antitoxin

Biofilm formation regulator YbaJ

(1-116)


Sequences

Toxin        


Download         Length: 73 a.a.        Molecular weight: 8628.00 Da        Isoelectric Point: 8.9008

>T254448 WP_002892050.1 NZ_CP102903:3997032-3997250 [Klebsiella quasipneumoniae]
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPTSVWKFIR

Download         Length: 219 bp

Antitoxin


Download         Length: 125 a.a.        Molecular weight: 14368.06 Da        Isoelectric Point: 4.8989

>AT254448 WP_002892066.1 NZ_CP102903:3996631-3997005 [Klebsiella quasipneumoniae]
MDEYSPKRHDIAQLRFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYAEDNKLIAQVDEYL
DDTFTLFSNYGINSTDLQKWKKSGNRLFRCFVNASRENPASLSC

Download         Length: 375 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A2P8K6F2

Antitoxin

Source ID Structure
AlphaFold DB A0A0H3GJ93

References