Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | cptAB/Cpta(toxin) |
| Location | 779367..780024 | Replicon | chromosome |
| Accession | NZ_CP102903 | ||
| Organism | Klebsiella quasipneumoniae strain KW4 | ||
Toxin (Protein)
| Gene name | cptA | Uniprot ID | A0A2N4VX63 |
| Locus tag | NWT71_RS03850 | Protein ID | WP_023290968.1 |
| Coordinates | 779614..780024 (+) | Length | 137 a.a. |
Antitoxin (Protein)
| Gene name | cptB | Uniprot ID | W8UQ37 |
| Locus tag | NWT71_RS03845 | Protein ID | WP_002916312.1 |
| Coordinates | 779367..779633 (+) | Length | 89 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NWT71_RS03820 (774535) | 774535..775968 | - | 1434 | WP_065883832.1 | 6-phospho-beta-glucosidase | - |
| NWT71_RS03825 (776087) | 776087..776815 | - | 729 | WP_032454033.1 | MurR/RpiR family transcriptional regulator | - |
| NWT71_RS03830 (776866) | 776866..777177 | + | 312 | WP_065883829.1 | N(4)-acetylcytidine aminohydrolase | - |
| NWT71_RS03835 (777341) | 777341..778003 | + | 663 | WP_065883827.1 | hemolysin III family protein | - |
| NWT71_RS03840 (778138) | 778138..779121 | - | 984 | WP_065883825.1 | tRNA-modifying protein YgfZ | - |
| NWT71_RS03845 (779367) | 779367..779633 | + | 267 | WP_002916312.1 | FAD assembly factor SdhE | Antitoxin |
| NWT71_RS03850 (779614) | 779614..780024 | + | 411 | WP_023290968.1 | protein YgfX | Toxin |
| NWT71_RS03855 (780031) | 780031..780552 | - | 522 | WP_004205324.1 | flavodoxin FldB | - |
| NWT71_RS03860 (780653) | 780653..781549 | + | 897 | WP_004144729.1 | site-specific tyrosine recombinase XerD | - |
| NWT71_RS03865 (781572) | 781572..782285 | + | 714 | WP_002916301.1 | bifunctional protein-disulfide isomerase/oxidoreductase DsbC | - |
| NWT71_RS03870 (782291) | 782291..784024 | + | 1734 | WP_065883824.1 | single-stranded-DNA-specific exonuclease RecJ | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 137 a.a. Molecular weight: 16075.89 Da Isoelectric Point: 11.4778
>T254440 WP_023290968.1 NZ_CP102903:779614-780024 [Klebsiella quasipneumoniae]
VVLWQSDLRISWRAQWFSLLLHGVVAALVLLVPWPLSYTPIWLLLLSLVVFDCVRSQRRIHARRGEIKLLTDSRLRWQNA
EWEILGTPWVINSGMLLRLRHVDTRRGQHLWLAADSMDPGEWRDLRRLVLQKPAQE
VVLWQSDLRISWRAQWFSLLLHGVVAALVLLVPWPLSYTPIWLLLLSLVVFDCVRSQRRIHARRGEIKLLTDSRLRWQNA
EWEILGTPWVINSGMLLRLRHVDTRRGQHLWLAADSMDPGEWRDLRRLVLQKPAQE
Download Length: 411 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A2N4VX63 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0H3GY41 |