Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) ccdAB/CcdA(antitoxin)
Location 5856..6381 Replicon plasmid pKW1-1
Accession NZ_CP102899
Organism Klebsiella quasipneumoniae strain KW1

Toxin (Protein)


Gene name ccdB Uniprot ID D4HQE7
Locus tag NWT83_RS25450 Protein ID WP_013023785.1
Coordinates 5856..6161 (-) Length 102 a.a.

Antitoxin (Protein)


Gene name ccdA Uniprot ID W8V2V6
Locus tag NWT83_RS25455 Protein ID WP_001568025.1
Coordinates 6163..6381 (-) Length 73 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NWT83_RS25420 (NWT83_25420) 1559..2185 + 627 WP_004197649.1 ParA family plasmid-partitioning AAA ATPase -
NWT83_RS25425 (NWT83_25425) 2182..2484 + 303 WP_004197636.1 hypothetical protein -
NWT83_RS25430 (NWT83_25430) 2932..3726 - 795 WP_004197635.1 site-specific integrase -
NWT83_RS25435 (NWT83_25435) 3924..4940 - 1017 WP_017899884.1 hypothetical protein -
NWT83_RS25440 (NWT83_25440) 4951..5265 - 315 WP_053389906.1 hypothetical protein -
NWT83_RS25445 (NWT83_25445) 5292..5687 - 396 WP_017899885.1 hypothetical protein -
NWT83_RS25450 (NWT83_25450) 5856..6161 - 306 WP_013023785.1 type II toxin-antitoxin system toxin CcdB Toxin
NWT83_RS25455 (NWT83_25455) 6163..6381 - 219 WP_001568025.1 type II toxin-antitoxin system antitoxin CcdA Antitoxin
NWT83_RS25460 (NWT83_25460) 7199..7489 - 291 WP_013023783.1 hypothetical protein -
NWT83_RS25465 (NWT83_25465) 7486..8613 - 1128 WP_013023782.1 DUF4238 domain-containing protein -
NWT83_RS25470 (NWT83_25470) 8647..10170 - 1524 WP_017899887.1 hypothetical protein -
NWT83_RS25475 (NWT83_25475) 10446..11225 - 780 WP_013023780.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Non-Mobilizable plasmid floR / sul2 / aph(4)-Ia / aac(3)-IVa / aph(3')-Ia / aadA2 / dfrA12 / tet(A) / blaLAP-2 / qnrS1 - 1..93612 93612


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin CcdB

(2-100)

Antitoxin

Post-segregation antitoxin CcdA

(2-72)


Sequences

Toxin        


Download         Length: 102 a.a.        Molecular weight: 11615.30 Da        Isoelectric Point: 6.4672

>T254439 WP_013023785.1 NZ_CP102899:c6161-5856 [Klebsiella quasipneumoniae]
MQFKVYAYKRESRYRLFVDVQSDIIDTPGRRMVIPLASARLLSDKVSRELYPVVHIGDESYRLMTTDMASVTSSVTGEEV
ADLSHRENDIKNAINLMFWGI

Download         Length: 306 bp

Antitoxin


Download         Length: 73 a.a.        Molecular weight: 8392.34 Da        Isoelectric Point: 4.7405

>AT254439 WP_001568025.1 NZ_CP102899:c6381-6163 [Klebsiella quasipneumoniae]
MKQRITVTIDSDSYQLLKSADVNISALVNRAMQNEARRLRSERWQAENQEGMAEVARFIEMNGSFADENRDW

Download         Length: 219 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A2J4ZZW6

Antitoxin

Source ID Structure
AlphaFold DB A0A2J4ZZP8

References