Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) Hha-TomB/-
Location 3998362..3998981 Replicon chromosome
Accession NZ_CP102898
Organism Klebsiella quasipneumoniae strain KW1

Toxin (Protein)


Gene name Hha Uniprot ID R8WYV2
Locus tag NWT83_RS19585 Protein ID WP_002892050.1
Coordinates 3998763..3998981 (+) Length 73 a.a.

Antitoxin (Protein)


Gene name TomB Uniprot ID J2DPF6
Locus tag NWT83_RS19580 Protein ID WP_002892066.1
Coordinates 3998362..3998736 (+) Length 125 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NWT83_RS19570 (3993516) 3993516..3994709 + 1194 WP_023288645.1 multidrug efflux RND transporter periplasmic adaptor subunit AcrA -
NWT83_RS19575 (3994732) 3994732..3997878 + 3147 WP_065882810.1 multidrug efflux RND transporter permease subunit AcrB -
NWT83_RS19580 (3998362) 3998362..3998736 + 375 WP_002892066.1 Hha toxicity modulator TomB Antitoxin
NWT83_RS19585 (3998763) 3998763..3998981 + 219 WP_002892050.1 HHA domain-containing protein Toxin
NWT83_RS19590 (3999140) 3999140..3999706 + 567 WP_023288643.1 maltose O-acetyltransferase -
NWT83_RS19595 (3999678) 3999678..3999809 - 132 WP_032428629.1 hypothetical protein -
NWT83_RS19600 (3999843) 3999843..4000313 + 471 WP_023288642.1 YlaC family protein -
NWT83_RS19605 (4000282) 4000282..4001739 - 1458 WP_065882811.1 PLP-dependent aminotransferase family protein -
NWT83_RS19610 (4001840) 4001840..4002538 + 699 WP_065882812.1 GNAT family protein -
NWT83_RS19615 (4002535) 4002535..4002675 - 141 WP_002892018.1 type B 50S ribosomal protein L36 -
NWT83_RS19620 (4002675) 4002675..4002938 - 264 WP_004204754.1 type B 50S ribosomal protein L31 -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Haemolysin expression modulating, HHA

(13-69)

Antitoxin

Biofilm formation regulator YbaJ

(1-116)


Sequences

Toxin        


Download         Length: 73 a.a.        Molecular weight: 8628.00 Da        Isoelectric Point: 8.9008

>T254438 WP_002892050.1 NZ_CP102898:3998763-3998981 [Klebsiella quasipneumoniae]
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPTSVWKFIR

Download         Length: 219 bp

Antitoxin


Download         Length: 125 a.a.        Molecular weight: 14368.06 Da        Isoelectric Point: 4.8989

>AT254438 WP_002892066.1 NZ_CP102898:3998362-3998736 [Klebsiella quasipneumoniae]
MDEYSPKRHDIAQLRFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYAEDNKLIAQVDEYL
DDTFTLFSNYGINSTDLQKWKKSGNRLFRCFVNASRENPASLSC

Download         Length: 375 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A2P8K6F2

Antitoxin

Source ID Structure
AlphaFold DB A0A0H3GJ93

References