Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | cptAB/Cpta(toxin) |
| Location | 779534..780191 | Replicon | chromosome |
| Accession | NZ_CP102898 | ||
| Organism | Klebsiella quasipneumoniae strain KW1 | ||
Toxin (Protein)
| Gene name | cptA | Uniprot ID | A0A2N4VX63 |
| Locus tag | NWT83_RS03855 | Protein ID | WP_023290968.1 |
| Coordinates | 779781..780191 (+) | Length | 137 a.a. |
Antitoxin (Protein)
| Gene name | cptB | Uniprot ID | W8UQ37 |
| Locus tag | NWT83_RS03850 | Protein ID | WP_002916312.1 |
| Coordinates | 779534..779800 (+) | Length | 89 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NWT83_RS03825 (774702) | 774702..776135 | - | 1434 | WP_065883832.1 | 6-phospho-beta-glucosidase | - |
| NWT83_RS03830 (776254) | 776254..776982 | - | 729 | WP_032454033.1 | MurR/RpiR family transcriptional regulator | - |
| NWT83_RS03835 (777033) | 777033..777344 | + | 312 | WP_065883829.1 | N(4)-acetylcytidine aminohydrolase | - |
| NWT83_RS03840 (777508) | 777508..778170 | + | 663 | WP_065883827.1 | hemolysin III family protein | - |
| NWT83_RS03845 (778305) | 778305..779288 | - | 984 | WP_065883825.1 | tRNA-modifying protein YgfZ | - |
| NWT83_RS03850 (779534) | 779534..779800 | + | 267 | WP_002916312.1 | FAD assembly factor SdhE | Antitoxin |
| NWT83_RS03855 (779781) | 779781..780191 | + | 411 | WP_023290968.1 | protein YgfX | Toxin |
| NWT83_RS03860 (780198) | 780198..780719 | - | 522 | WP_004205324.1 | flavodoxin FldB | - |
| NWT83_RS03865 (780820) | 780820..781716 | + | 897 | WP_004144729.1 | site-specific tyrosine recombinase XerD | - |
| NWT83_RS03870 (781739) | 781739..782452 | + | 714 | WP_002916301.1 | bifunctional protein-disulfide isomerase/oxidoreductase DsbC | - |
| NWT83_RS03875 (782458) | 782458..784191 | + | 1734 | WP_065883824.1 | single-stranded-DNA-specific exonuclease RecJ | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 137 a.a. Molecular weight: 16075.89 Da Isoelectric Point: 11.4778
>T254430 WP_023290968.1 NZ_CP102898:779781-780191 [Klebsiella quasipneumoniae]
VVLWQSDLRISWRAQWFSLLLHGVVAALVLLVPWPLSYTPIWLLLLSLVVFDCVRSQRRIHARRGEIKLLTDSRLRWQNA
EWEILGTPWVINSGMLLRLRHVDTRRGQHLWLAADSMDPGEWRDLRRLVLQKPAQE
VVLWQSDLRISWRAQWFSLLLHGVVAALVLLVPWPLSYTPIWLLLLSLVVFDCVRSQRRIHARRGEIKLLTDSRLRWQNA
EWEILGTPWVINSGMLLRLRHVDTRRGQHLWLAADSMDPGEWRDLRRLVLQKPAQE
Download Length: 411 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A2N4VX63 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0H3GY41 |