Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) ccdAB/CcdA(antitoxin)
Location 5013..5538 Replicon plasmid pKA1-2
Accession NZ_CP102895
Organism Klebsiella quasipneumoniae strain KA1

Toxin (Protein)


Gene name ccdB Uniprot ID A0A1D8K3Q5
Locus tag NWT75_RS26240 Protein ID WP_006788214.1
Coordinates 5013..5318 (-) Length 102 a.a.

Antitoxin (Protein)


Gene name ccdA Uniprot ID A0A1D8K3R4
Locus tag NWT75_RS26245 Protein ID WP_006788213.1
Coordinates 5320..5538 (-) Length 73 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NWT75_RS26215 (NWT75_26215) 19..894 + 876 WP_004098982.1 replication initiation protein -
NWT75_RS26220 (NWT75_26220) 1462..2088 + 627 WP_016946792.1 ParA family plasmid-partitioning AAA ATPase -
NWT75_RS26225 (NWT75_26225) 2085..2387 + 303 WP_004197636.1 hypothetical protein -
NWT75_RS26230 (NWT75_26230) 2811..3605 - 795 WP_065801584.1 site-specific integrase -
NWT75_RS26235 (NWT75_26235) 3803..4819 - 1017 WP_006788215.1 hypothetical protein -
NWT75_RS26240 (NWT75_26240) 5013..5318 - 306 WP_006788214.1 type II toxin-antitoxin system toxin CcdB Toxin
NWT75_RS26245 (NWT75_26245) 5320..5538 - 219 WP_006788213.1 type II toxin-antitoxin system antitoxin CcdA Antitoxin
NWT75_RS26250 (NWT75_26250) 5708..5938 - 231 Protein_7 hypothetical protein -
NWT75_RS26255 (NWT75_26255) 6250..8871 + 2622 WP_000283688.1 histidinol-phosphatase -
NWT75_RS26260 (NWT75_26260) 9070..9300 + 231 WP_001261274.1 type II toxin-antitoxin system VapB family antitoxin -
NWT75_RS26265 (NWT75_26265) 9297..9613 + 317 Protein_10 type II toxin-antitoxin system VapC family toxin -
NWT75_RS26270 (NWT75_26270) 9669..9886 - 218 Protein_11 transposase -
NWT75_RS26275 (NWT75_26275) 9887..10417 - 531 WP_000348883.1 GNAT family N-acetyltransferase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Mobilizable plasmid aph(6)-Id / aph(3'')-Ib / tet(A) / sul1 / qnrB2 / qacE / aadA16 / dfrA27 / ARR-3 / aac(6')-Ib-cr / floR / sul2 / aph(4)-Ia / aac(3)-IVa - 1..85913 85913


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin CcdB

(2-100)

Antitoxin

Post-segregation antitoxin CcdA

(2-72)


Sequences

Toxin        


Download         Length: 102 a.a.        Molecular weight: 11687.46 Da        Isoelectric Point: 7.2015

>T254428 WP_006788214.1 NZ_CP102895:c5318-5013 [Klebsiella quasipneumoniae]
MQFKVYAYKRESRYRLFVDVQSDIIDTPGRRMVIPLASARLLSDKVSRELYPVVHIGDESWRLMTTDMASVPASVTGEEV
ADLRHRENDIKNAINLMFWGI

Download         Length: 306 bp

Antitoxin


Download         Length: 73 a.a.        Molecular weight: 8362.31 Da        Isoelectric Point: 4.7405

>AT254428 WP_006788213.1 NZ_CP102895:c5538-5320 [Klebsiella quasipneumoniae]
MKQRITVTIDSDSYQLLKSADVNISGLVNRAMQNEARRLRAERWQAENQEGMAEVARFIEMNGSFADENRDW

Download         Length: 219 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A1D8K3Q5

Antitoxin

Source ID Structure
AlphaFold DB A0A1D8K3R4

References