Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | ccdAB/CcdA(antitoxin) |
| Location | 5013..5538 | Replicon | plasmid pKA1-2 |
| Accession | NZ_CP102895 | ||
| Organism | Klebsiella quasipneumoniae strain KA1 | ||
Toxin (Protein)
| Gene name | ccdB | Uniprot ID | A0A1D8K3Q5 |
| Locus tag | NWT75_RS26240 | Protein ID | WP_006788214.1 |
| Coordinates | 5013..5318 (-) | Length | 102 a.a. |
Antitoxin (Protein)
| Gene name | ccdA | Uniprot ID | A0A1D8K3R4 |
| Locus tag | NWT75_RS26245 | Protein ID | WP_006788213.1 |
| Coordinates | 5320..5538 (-) | Length | 73 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NWT75_RS26215 (NWT75_26215) | 19..894 | + | 876 | WP_004098982.1 | replication initiation protein | - |
| NWT75_RS26220 (NWT75_26220) | 1462..2088 | + | 627 | WP_016946792.1 | ParA family plasmid-partitioning AAA ATPase | - |
| NWT75_RS26225 (NWT75_26225) | 2085..2387 | + | 303 | WP_004197636.1 | hypothetical protein | - |
| NWT75_RS26230 (NWT75_26230) | 2811..3605 | - | 795 | WP_065801584.1 | site-specific integrase | - |
| NWT75_RS26235 (NWT75_26235) | 3803..4819 | - | 1017 | WP_006788215.1 | hypothetical protein | - |
| NWT75_RS26240 (NWT75_26240) | 5013..5318 | - | 306 | WP_006788214.1 | type II toxin-antitoxin system toxin CcdB | Toxin |
| NWT75_RS26245 (NWT75_26245) | 5320..5538 | - | 219 | WP_006788213.1 | type II toxin-antitoxin system antitoxin CcdA | Antitoxin |
| NWT75_RS26250 (NWT75_26250) | 5708..5938 | - | 231 | Protein_7 | hypothetical protein | - |
| NWT75_RS26255 (NWT75_26255) | 6250..8871 | + | 2622 | WP_000283688.1 | histidinol-phosphatase | - |
| NWT75_RS26260 (NWT75_26260) | 9070..9300 | + | 231 | WP_001261274.1 | type II toxin-antitoxin system VapB family antitoxin | - |
| NWT75_RS26265 (NWT75_26265) | 9297..9613 | + | 317 | Protein_10 | type II toxin-antitoxin system VapC family toxin | - |
| NWT75_RS26270 (NWT75_26270) | 9669..9886 | - | 218 | Protein_11 | transposase | - |
| NWT75_RS26275 (NWT75_26275) | 9887..10417 | - | 531 | WP_000348883.1 | GNAT family N-acetyltransferase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Mobilizable plasmid | aph(6)-Id / aph(3'')-Ib / tet(A) / sul1 / qnrB2 / qacE / aadA16 / dfrA27 / ARR-3 / aac(6')-Ib-cr / floR / sul2 / aph(4)-Ia / aac(3)-IVa | - | 1..85913 | 85913 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 102 a.a. Molecular weight: 11687.46 Da Isoelectric Point: 7.2015
>T254428 WP_006788214.1 NZ_CP102895:c5318-5013 [Klebsiella quasipneumoniae]
MQFKVYAYKRESRYRLFVDVQSDIIDTPGRRMVIPLASARLLSDKVSRELYPVVHIGDESWRLMTTDMASVPASVTGEEV
ADLRHRENDIKNAINLMFWGI
MQFKVYAYKRESRYRLFVDVQSDIIDTPGRRMVIPLASARLLSDKVSRELYPVVHIGDESWRLMTTDMASVPASVTGEEV
ADLRHRENDIKNAINLMFWGI
Download Length: 306 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A1D8K3Q5 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A1D8K3R4 |