Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vagCD/VapC-VagC |
| Location | 82819..83462 | Replicon | plasmid pKA1-1 |
| Accession | NZ_CP102894 | ||
| Organism | Klebsiella quasipneumoniae strain KA1 | ||
Toxin (Protein)
| Gene name | vagD | Uniprot ID | - |
| Locus tag | NWT75_RS25710 | Protein ID | WP_048298725.1 |
| Coordinates | 82819..83235 (-) | Length | 139 a.a. |
Antitoxin (Protein)
| Gene name | vagC | Uniprot ID | A0A853H7M9 |
| Locus tag | NWT75_RS25715 | Protein ID | WP_001261275.1 |
| Coordinates | 83232..83462 (-) | Length | 77 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NWT75_RS25680 (NWT75_25680) | 78287..78430 | - | 144 | Protein_81 | MbeD family mobilization/exclusion protein | - |
| NWT75_RS25685 (NWT75_25685) | 78490..78912 | - | 423 | Protein_82 | integrase core domain-containing protein | - |
| NWT75_RS25690 (NWT75_25690) | 78957..79925 | + | 969 | WP_214184160.1 | IS5-like element IS903B family transposase | - |
| NWT75_RS25700 (NWT75_25700) | 80898..81062 | - | 165 | WP_258336605.1 | hypothetical protein | - |
| NWT75_RS25710 (NWT75_25710) | 82819..83235 | - | 417 | WP_048298725.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
| NWT75_RS25715 (NWT75_25715) | 83232..83462 | - | 231 | WP_001261275.1 | type II toxin-antitoxin system VapB family antitoxin | Antitoxin |
| NWT75_RS25720 (NWT75_25720) | 83715..86291 | - | 2577 | WP_017901322.1 | nuclease domain-containing protein | - |
| NWT75_RS25725 (NWT75_25725) | 86294..88195 | - | 1902 | WP_258336607.1 | AAA family ATPase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Non-Mobilizable plasmid | - | - | 1..184774 | 184774 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 139 a.a. Molecular weight: 15094.58 Da Isoelectric Point: 8.5403
>T254427 WP_048298725.1 NZ_CP102894:c83235-82819 [Klebsiella quasipneumoniae]
MKKTWMLDTNICSFIMREQPAAVLKRLEQVVLRGDRIVVSAVTYAEMRFGATGPKASPRHIQLVDAFCARLDAILPWDRA
AVDATTDIRVALRLAGTPIGPNDTAIAGHAIAAGAVLVTNNTREFERVPGLVLEDWVK
MKKTWMLDTNICSFIMREQPAAVLKRLEQVVLRGDRIVVSAVTYAEMRFGATGPKASPRHIQLVDAFCARLDAILPWDRA
AVDATTDIRVALRLAGTPIGPNDTAIAGHAIAAGAVLVTNNTREFERVPGLVLEDWVK
Download Length: 417 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|