Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) Hha-TomB/-
Location 3956262..3956881 Replicon chromosome
Accession NZ_CP102893
Organism Klebsiella quasipneumoniae strain KA1

Toxin (Protein)


Gene name Hha Uniprot ID R8WYV2
Locus tag NWT75_RS19195 Protein ID WP_002892050.1
Coordinates 3956663..3956881 (+) Length 73 a.a.

Antitoxin (Protein)


Gene name TomB Uniprot ID J2DPF6
Locus tag NWT75_RS19190 Protein ID WP_002892066.1
Coordinates 3956262..3956636 (+) Length 125 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NWT75_RS19180 (3951416) 3951416..3952609 + 1194 WP_023288645.1 multidrug efflux RND transporter periplasmic adaptor subunit AcrA -
NWT75_RS19185 (3952632) 3952632..3955778 + 3147 WP_065882810.1 multidrug efflux RND transporter permease subunit AcrB -
NWT75_RS19190 (3956262) 3956262..3956636 + 375 WP_002892066.1 Hha toxicity modulator TomB Antitoxin
NWT75_RS19195 (3956663) 3956663..3956881 + 219 WP_002892050.1 HHA domain-containing protein Toxin
NWT75_RS19200 (3957040) 3957040..3957606 + 567 WP_258336413.1 maltose O-acetyltransferase -
NWT75_RS19205 (3957578) 3957578..3957709 - 132 WP_032428629.1 hypothetical protein -
NWT75_RS19210 (3957743) 3957743..3958213 + 471 WP_023288642.1 YlaC family protein -
NWT75_RS19215 (3958182) 3958182..3959639 - 1458 WP_065882811.1 PLP-dependent aminotransferase family protein -
NWT75_RS19220 (3959740) 3959740..3960438 + 699 WP_065882812.1 GNAT family protein -
NWT75_RS19225 (3960435) 3960435..3960575 - 141 WP_002892018.1 type B 50S ribosomal protein L36 -
NWT75_RS19230 (3960575) 3960575..3960838 - 264 WP_004204754.1 type B 50S ribosomal protein L31 -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Haemolysin expression modulating, HHA

(13-69)

Antitoxin

Biofilm formation regulator YbaJ

(1-116)


Sequences

Toxin        


Download         Length: 73 a.a.        Molecular weight: 8628.00 Da        Isoelectric Point: 8.9008

>T254425 WP_002892050.1 NZ_CP102893:3956663-3956881 [Klebsiella quasipneumoniae]
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPTSVWKFIR

Download         Length: 219 bp

Antitoxin


Download         Length: 125 a.a.        Molecular weight: 14368.06 Da        Isoelectric Point: 4.8989

>AT254425 WP_002892066.1 NZ_CP102893:3956262-3956636 [Klebsiella quasipneumoniae]
MDEYSPKRHDIAQLRFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYAEDNKLIAQVDEYL
DDTFTLFSNYGINSTDLQKWKKSGNRLFRCFVNASRENPASLSC

Download         Length: 375 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A2P8K6F2

Antitoxin

Source ID Structure
AlphaFold DB A0A0H3GJ93

References