Detailed information of TA system
Overview
TA module
Type | II | Classification (family/domain) | pemIK/PRK09812-MazE |
Location | 1760457..1761047 | Replicon | chromosome |
Accession | NZ_CP102893 | ||
Organism | Klebsiella quasipneumoniae strain KA1 |
Toxin (Protein)
Gene name | pemK | Uniprot ID | A0A1F2LYA2 |
Locus tag | NWT75_RS08485 | Protein ID | WP_008804165.1 |
Coordinates | 1760715..1761047 (+) | Length | 111 a.a. |
Antitoxin (Protein)
Gene name | pemI | Uniprot ID | - |
Locus tag | NWT75_RS08480 | Protein ID | WP_129675475.1 |
Coordinates | 1760457..1760714 (+) | Length | 86 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NWT75_RS08475 (1757947) | 1757947..1759896 | - | 1950 | WP_101825858.1 | hypothetical protein | - |
NWT75_RS08480 (1760457) | 1760457..1760714 | + | 258 | WP_129675475.1 | antitoxin | Antitoxin |
NWT75_RS08485 (1760715) | 1760715..1761047 | + | 333 | WP_008804165.1 | type II toxin-antitoxin system PemK/MazF family toxin | Toxin |
NWT75_RS08495 (1761371) | 1761371..1762807 | + | 1437 | WP_016161429.1 | EmmdR/YeeO family multidrug/toxin efflux MATE transporter | - |
NWT75_RS08505 (1763180) | 1763180..1764634 | - | 1455 | WP_258336537.1 | AMP nucleosidase | - |
NWT75_RS08510 (1764765) | 1764765..1765010 | - | 246 | WP_008804171.1 | signal transduction protein PmrD | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Genomic island | - | - | 1752863..1761047 | 8184 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 111 a.a. Molecular weight: 11867.71 Da Isoelectric Point: 10.1839
>T254418 WP_008804165.1 NZ_CP102893:1760715-1761047 [Klebsiella quasipneumoniae]
MDRGEIWLVSLDPIAGHEQSGKRPVLIVSKASFNKLTRLPVVVPVTSGGNFARTAGFTVSLEEAGTKTTGVIRCDQPRTI
DMAARNGKRLERIPDAVVNEVLARLDAILS
MDRGEIWLVSLDPIAGHEQSGKRPVLIVSKASFNKLTRLPVVVPVTSGGNFARTAGFTVSLEEAGTKTTGVIRCDQPRTI
DMAARNGKRLERIPDAVVNEVLARLDAILS
Download Length: 333 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|