Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | IV | Classification (family/domain) | cptAB/Cpta(toxin) |
Location | 785610..786267 | Replicon | chromosome |
Accession | NZ_CP102893 | ||
Organism | Klebsiella quasipneumoniae strain KA1 |
Toxin (Protein)
Gene name | cptA | Uniprot ID | A0A2N4VX63 |
Locus tag | NWT75_RS03875 | Protein ID | WP_023290968.1 |
Coordinates | 785857..786267 (+) | Length | 137 a.a. |
Antitoxin (Protein)
Gene name | cptB | Uniprot ID | W8UQ37 |
Locus tag | NWT75_RS03870 | Protein ID | WP_002916312.1 |
Coordinates | 785610..785876 (+) | Length | 89 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NWT75_RS03845 (780778) | 780778..782211 | - | 1434 | WP_065883832.1 | 6-phospho-beta-glucosidase | - |
NWT75_RS03850 (782330) | 782330..783058 | - | 729 | WP_032454033.1 | MurR/RpiR family transcriptional regulator | - |
NWT75_RS03855 (783109) | 783109..783420 | + | 312 | WP_065883829.1 | N(4)-acetylcytidine aminohydrolase | - |
NWT75_RS03860 (783584) | 783584..784246 | + | 663 | WP_065883827.1 | hemolysin III family protein | - |
NWT75_RS03865 (784381) | 784381..785364 | - | 984 | WP_065883825.1 | tRNA-modifying protein YgfZ | - |
NWT75_RS03870 (785610) | 785610..785876 | + | 267 | WP_002916312.1 | FAD assembly factor SdhE | Antitoxin |
NWT75_RS03875 (785857) | 785857..786267 | + | 411 | WP_023290968.1 | protein YgfX | Toxin |
NWT75_RS03880 (786274) | 786274..786795 | - | 522 | WP_004205324.1 | flavodoxin FldB | - |
NWT75_RS03885 (786896) | 786896..787792 | + | 897 | WP_004144729.1 | site-specific tyrosine recombinase XerD | - |
NWT75_RS03890 (787815) | 787815..788528 | + | 714 | WP_002916301.1 | bifunctional protein-disulfide isomerase/oxidoreductase DsbC | - |
NWT75_RS03895 (788534) | 788534..790267 | + | 1734 | WP_258336474.1 | single-stranded-DNA-specific exonuclease RecJ | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 137 a.a. Molecular weight: 16075.89 Da Isoelectric Point: 11.4778
>T254416 WP_023290968.1 NZ_CP102893:785857-786267 [Klebsiella quasipneumoniae]
VVLWQSDLRISWRAQWFSLLLHGVVAALVLLVPWPLSYTPIWLLLLSLVVFDCVRSQRRIHARRGEIKLLTDSRLRWQNA
EWEILGTPWVINSGMLLRLRHVDTRRGQHLWLAADSMDPGEWRDLRRLVLQKPAQE
VVLWQSDLRISWRAQWFSLLLHGVVAALVLLVPWPLSYTPIWLLLLSLVVFDCVRSQRRIHARRGEIKLLTDSRLRWQNA
EWEILGTPWVINSGMLLRLRHVDTRRGQHLWLAADSMDPGEWRDLRRLVLQKPAQE
Download Length: 411 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A2N4VX63 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0H3GY41 |