Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) Hha-TomB/-
Location 4004686..4005305 Replicon chromosome
Accession NZ_CP102891
Organism Klebsiella pneumoniae strain KW3

Toxin (Protein)


Gene name Hha Uniprot ID R8WYV2
Locus tag NWT73_RS19545 Protein ID WP_002892050.1
Coordinates 4005087..4005305 (+) Length 73 a.a.

Antitoxin (Protein)


Gene name TomB Uniprot ID J2DPF6
Locus tag NWT73_RS19540 Protein ID WP_002892066.1
Coordinates 4004686..4005060 (+) Length 125 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NWT73_RS19530 (NWT73_19530) 3999838..4001031 + 1194 WP_004177236.1 multidrug efflux RND transporter periplasmic adaptor subunit AcrA -
NWT73_RS19535 (NWT73_19535) 4001054..4004200 + 3147 WP_002892069.1 multidrug efflux RND transporter permease subunit AcrB -
NWT73_RS19540 (NWT73_19540) 4004686..4005060 + 375 WP_002892066.1 Hha toxicity modulator TomB Antitoxin
NWT73_RS19545 (NWT73_19545) 4005087..4005305 + 219 WP_002892050.1 HHA domain-containing protein Toxin
NWT73_RS19550 (NWT73_19550) 4005464..4006030 + 567 WP_002892030.1 maltose O-acetyltransferase -
NWT73_RS19555 (NWT73_19555) 4006002..4006142 - 141 WP_004147370.1 hypothetical protein -
NWT73_RS19560 (NWT73_19560) 4006163..4006633 + 471 WP_002892026.1 YlaC family protein -
NWT73_RS19565 (NWT73_19565) 4006608..4008059 - 1452 WP_002892023.1 PLP-dependent aminotransferase family protein -
NWT73_RS19570 (NWT73_19570) 4008160..4008858 + 699 WP_002892021.1 GNAT family protein -
NWT73_RS19575 (NWT73_19575) 4008855..4008995 - 141 WP_002892018.1 type B 50S ribosomal protein L36 -
NWT73_RS19580 (NWT73_19580) 4008995..4009258 - 264 WP_002892011.1 type B 50S ribosomal protein L31 -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Haemolysin expression modulating, HHA

(13-69)

Antitoxin

Biofilm formation regulator YbaJ

(1-116)


Sequences

Toxin        


Download         Length: 73 a.a.        Molecular weight: 8628.00 Da        Isoelectric Point: 8.9008

>T254411 WP_002892050.1 NZ_CP102891:4005087-4005305 [Klebsiella pneumoniae]
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPTSVWKFIR

Download         Length: 219 bp

Antitoxin


Download         Length: 125 a.a.        Molecular weight: 14368.06 Da        Isoelectric Point: 4.8989

>AT254411 WP_002892066.1 NZ_CP102891:4004686-4005060 [Klebsiella pneumoniae]
MDEYSPKRHDIAQLRFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYAEDNKLIAQVDEYL
DDTFTLFSNYGINSTDLQKWKKSGNRLFRCFVNASRENPASLSC

Download         Length: 375 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A2P8K6F2

Antitoxin

Source ID Structure
AlphaFold DB A0A0H3GJ93

References