Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | relBE/ParE-RelB |
| Location | 4710671..4711187 | Replicon | chromosome |
| Accession | NZ_CP102889 | ||
| Organism | Klebsiella pneumoniae strain KW2 | ||
Toxin (Protein)
| Gene name | relE | Uniprot ID | A0A2A2BGN7 |
| Locus tag | NWT79_RS22925 | Protein ID | WP_009486548.1 |
| Coordinates | 4710671..4710955 (-) | Length | 95 a.a. |
Antitoxin (Protein)
| Gene name | relB | Uniprot ID | R4Y888 |
| Locus tag | NWT79_RS22930 | Protein ID | WP_002886901.1 |
| Coordinates | 4710945..4711187 (-) | Length | 81 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NWT79_RS22900 (NWT79_22900) | 4706088..4706351 | - | 264 | WP_004152271.1 | PTS sugar transporter subunit IIB | - |
| NWT79_RS22905 (NWT79_22905) | 4706481..4706654 | + | 174 | WP_002886906.1 | hypothetical protein | - |
| NWT79_RS22910 (NWT79_22910) | 4706657..4707400 | + | 744 | WP_002886905.1 | MurR/RpiR family transcriptional regulator | - |
| NWT79_RS22915 (NWT79_22915) | 4707757..4709895 | + | 2139 | WP_004186701.1 | anaerobic ribonucleoside-triphosphate reductase | - |
| NWT79_RS22920 (NWT79_22920) | 4710203..4710667 | + | 465 | WP_004178375.1 | anaerobic ribonucleoside-triphosphate reductase-activating protein | - |
| NWT79_RS22925 (NWT79_22925) | 4710671..4710955 | - | 285 | WP_009486548.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| NWT79_RS22930 (NWT79_22930) | 4710945..4711187 | - | 243 | WP_002886901.1 | type II toxin-antitoxin system RelB/DinJ family antitoxin | Antitoxin |
| NWT79_RS22935 (NWT79_22935) | 4711265..4713175 | - | 1911 | WP_023288161.1 | PRD domain-containing protein | - |
| NWT79_RS22940 (NWT79_22940) | 4713198..4714352 | - | 1155 | WP_002886900.1 | lactonase family protein | - |
| NWT79_RS22945 (NWT79_22945) | 4714419..4715159 | - | 741 | WP_004186692.1 | KDGP aldolase family protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 95 a.a. Molecular weight: 11125.95 Da Isoelectric Point: 10.4951
>T254400 WP_009486548.1 NZ_CP102889:c4710955-4710671 [Klebsiella pneumoniae]
MTYELEFDPRARREWQKPGETVKKQFKNKLQQIVQNPRIESTRLSDLPDCYKIKLKASGYRLVYQVRDSVVVVYVIAIGK
REKAAVYHQANKRL
MTYELEFDPRARREWQKPGETVKKQFKNKLQQIVQNPRIESTRLSDLPDCYKIKLKASGYRLVYQVRDSVVVVYVIAIGK
REKAAVYHQANKRL
Download Length: 285 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A2A2BGN7 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0H3GLP0 |