Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) Hha-TomB/-
Location 4004678..4005297 Replicon chromosome
Accession NZ_CP102889
Organism Klebsiella pneumoniae strain KW2

Toxin (Protein)


Gene name Hha Uniprot ID R8WYV2
Locus tag NWT79_RS19545 Protein ID WP_002892050.1
Coordinates 4005079..4005297 (+) Length 73 a.a.

Antitoxin (Protein)


Gene name TomB Uniprot ID J2DPF6
Locus tag NWT79_RS19540 Protein ID WP_002892066.1
Coordinates 4004678..4005052 (+) Length 125 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NWT79_RS19530 (NWT79_19530) 3999830..4001023 + 1194 WP_004177236.1 multidrug efflux RND transporter periplasmic adaptor subunit AcrA -
NWT79_RS19535 (NWT79_19535) 4001046..4004192 + 3147 WP_002892069.1 multidrug efflux RND transporter permease subunit AcrB -
NWT79_RS19540 (NWT79_19540) 4004678..4005052 + 375 WP_002892066.1 Hha toxicity modulator TomB Antitoxin
NWT79_RS19545 (NWT79_19545) 4005079..4005297 + 219 WP_002892050.1 HHA domain-containing protein Toxin
NWT79_RS19550 (NWT79_19550) 4005456..4006022 + 567 WP_002892030.1 maltose O-acetyltransferase -
NWT79_RS19555 (NWT79_19555) 4005994..4006134 - 141 WP_004147370.1 hypothetical protein -
NWT79_RS19560 (NWT79_19560) 4006155..4006625 + 471 WP_002892026.1 YlaC family protein -
NWT79_RS19565 (NWT79_19565) 4006600..4008051 - 1452 WP_002892023.1 PLP-dependent aminotransferase family protein -
NWT79_RS19570 (NWT79_19570) 4008152..4008850 + 699 WP_002892021.1 GNAT family protein -
NWT79_RS19575 (NWT79_19575) 4008847..4008987 - 141 WP_002892018.1 type B 50S ribosomal protein L36 -
NWT79_RS19580 (NWT79_19580) 4008987..4009250 - 264 WP_002892011.1 type B 50S ribosomal protein L31 -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Haemolysin expression modulating, HHA

(13-69)

Antitoxin

Biofilm formation regulator YbaJ

(1-116)


Sequences

Toxin        


Download         Length: 73 a.a.        Molecular weight: 8628.00 Da        Isoelectric Point: 8.9008

>T254398 WP_002892050.1 NZ_CP102889:4005079-4005297 [Klebsiella pneumoniae]
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPTSVWKFIR

Download         Length: 219 bp

Antitoxin


Download         Length: 125 a.a.        Molecular weight: 14368.06 Da        Isoelectric Point: 4.8989

>AT254398 WP_002892066.1 NZ_CP102889:4004678-4005052 [Klebsiella pneumoniae]
MDEYSPKRHDIAQLRFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYAEDNKLIAQVDEYL
DDTFTLFSNYGINSTDLQKWKKSGNRLFRCFVNASRENPASLSC

Download         Length: 375 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A2P8K6F2

Antitoxin

Source ID Structure
AlphaFold DB A0A0H3GJ93

References