Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | ccdAB/CcdA(antitoxin) |
Location | 30413..30938 | Replicon | plasmid pKH2-3-mcr8.1 |
Accession | NZ_CP102886 | ||
Organism | Klebsiella pneumoniae strain KH2 |
Toxin (Protein)
Gene name | ccdB | Uniprot ID | D4HQE7 |
Locus tag | M2890_RS28010 | Protein ID | WP_013023785.1 |
Coordinates | 30633..30938 (+) | Length | 102 a.a. |
Antitoxin (Protein)
Gene name | ccdA | Uniprot ID | W8V2V6 |
Locus tag | M2890_RS28005 | Protein ID | WP_001568025.1 |
Coordinates | 30413..30631 (+) | Length | 73 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
M2890_RS27985 (M2890_27985) | 25660..26628 | + | 969 | WP_075211999.1 | IS5 family transposase | - |
M2890_RS27990 (M2890_27990) | 27100..27891 | - | 792 | WP_221928726.1 | ribbon-helix-helix domain-containing protein | - |
M2890_RS27995 (M2890_27995) | 28074..29102 | - | 1029 | WP_032445668.1 | Abi family protein | - |
M2890_RS28000 (M2890_28000) | 29263..29844 | - | 582 | WP_072310991.1 | hypothetical protein | - |
M2890_RS28005 (M2890_28005) | 30413..30631 | + | 219 | WP_001568025.1 | type II toxin-antitoxin system antitoxin CcdA | Antitoxin |
M2890_RS28010 (M2890_28010) | 30633..30938 | + | 306 | WP_013023785.1 | type II toxin-antitoxin system toxin CcdB | Toxin |
M2890_RS28015 (M2890_28015) | 31107..31502 | + | 396 | WP_017899885.1 | hypothetical protein | - |
M2890_RS28020 (M2890_28020) | 31529..31852 | + | 324 | WP_004197641.1 | hypothetical protein | - |
M2890_RS28025 (M2890_28025) | 31849..32865 | + | 1017 | WP_118842534.1 | hypothetical protein | - |
M2890_RS28030 (M2890_28030) | 33063..33848 | + | 786 | WP_046664219.1 | site-specific integrase | - |
M2890_RS28035 (M2890_28035) | 34297..35052 | + | 756 | WP_001568031.1 | replication initiation protein RepE | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Conjugative plasmid | mcr-8 | - | 1..100448 | 100448 | |
- | flank | IS/Tn | mcr-8 | - | 19604..26628 | 7024 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 102 a.a. Molecular weight: 11615.30 Da Isoelectric Point: 6.4672
>T254389 WP_013023785.1 NZ_CP102886:30633-30938 [Klebsiella pneumoniae]
MQFKVYAYKRESRYRLFVDVQSDIIDTPGRRMVIPLASARLLSDKVSRELYPVVHIGDESYRLMTTDMASVTSSVTGEEV
ADLSHRENDIKNAINLMFWGI
MQFKVYAYKRESRYRLFVDVQSDIIDTPGRRMVIPLASARLLSDKVSRELYPVVHIGDESYRLMTTDMASVTSSVTGEEV
ADLSHRENDIKNAINLMFWGI
Download Length: 306 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A2J4ZZW6 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A2J4ZZP8 |