Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) vagCD/VapC-VagC
Location 48241..48884 Replicon plasmid pKH2-2
Accession NZ_CP102885
Organism Klebsiella pneumoniae strain KH2

Toxin (Protein)


Gene name vagD Uniprot ID D8L2J9
Locus tag M2890_RS27605 Protein ID WP_001044770.1
Coordinates 48468..48884 (+) Length 139 a.a.

Antitoxin (Protein)


Gene name vagC Uniprot ID D5KTK7
Locus tag M2890_RS27600 Protein ID WP_001261282.1
Coordinates 48241..48471 (+) Length 77 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
M2890_RS27560 (M2890_27560) 43443..43712 + 270 WP_000339857.1 hypothetical protein -
M2890_RS27565 (M2890_27565) 43889..44755 - 867 WP_004118283.1 replication initiation protein -
M2890_RS27570 (M2890_27570) 45285..45389 + 105 WP_032409716.1 hypothetical protein -
M2890_RS27575 (M2890_27575) 45518..45775 + 258 WP_000764642.1 hypothetical protein -
M2890_RS27580 (M2890_27580) 45833..46609 - 777 WP_020956881.1 tyrosine-type recombinase/integrase -
M2890_RS27585 (M2890_27585) 46621..47307 - 687 WP_020956882.1 hypothetical protein -
M2890_RS27590 (M2890_27590) 47371..47664 - 294 WP_020956883.1 hypothetical protein -
M2890_RS27595 (M2890_27595) 47823..48284 - 462 WP_074193041.1 hypothetical protein -
M2890_RS27600 (M2890_27600) 48241..48471 + 231 WP_001261282.1 type II toxin-antitoxin system VapB family antitoxin Antitoxin
M2890_RS27605 (M2890_27605) 48468..48884 + 417 WP_001044770.1 type II toxin-antitoxin system VapC family toxin Toxin
M2890_RS27610 (M2890_27610) 48958..50520 + 1563 WP_004206609.1 AAA family ATPase -
M2890_RS27615 (M2890_27615) 50505..51527 + 1023 WP_000361404.1 helicase UvrD -
M2890_RS27620 (M2890_27620) 52071..52979 + 909 WP_032411229.1 HNH endonuclease -
M2890_RS27625 (M2890_27625) 53165..53515 - 351 WP_004187110.1 DUF305 domain-containing protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Mobilizable plasmid aac(6')-Ib-cr / ARR-3 / dfrA27 / aadA16 / qacE / sul1 / qnrB52 / blaCTX-M-27 / floR - 1..101130 101130


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

PIN domain

(5-129)

Antitoxin

SpoVT-AbrB domain

(7-47)


Sequences

Toxin        


Download         Length: 139 a.a.        Molecular weight: 15106.52 Da        Isoelectric Point: 7.1084

>T254388 WP_001044770.1 NZ_CP102885:48468-48884 [Klebsiella pneumoniae]
VNKTYMLDTCICSFIMREQPEAVLKRLEQAVLRGQRIVVSAITYSEMRFGATGPKASPRHVELVDAFCARLDAILPWDRA
AVDATTEIKVALRMAGTPIGPNDTAIAGHAIAAGAVLVTNNTREFERVPGLVLEDWVR

Download         Length: 417 bp

Antitoxin


Download         Length: 77 a.a.        Molecular weight: 8756.83 Da        Isoelectric Point: 4.4692

>AT254388 WP_001261282.1 NZ_CP102885:48241-48471 [Klebsiella pneumoniae]
MRTVSIFKNGNNRAIRLPRDLDFEGVSELEIVREGDSIILRPVRPTWGSFAQFEKADPDFMAEREDVVSDEGRFNL

Download         Length: 231 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A0H3GYM2

Antitoxin

Source ID Structure
AlphaFold DB A0A0H3GZG3

References