Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | stbDE/ParE-YafN |
Location | 148459..148981 | Replicon | plasmid pKH2-1 |
Accession | NZ_CP102884 | ||
Organism | Klebsiella pneumoniae strain KH2 |
Toxin (Protein)
Gene name | stbE | Uniprot ID | A0A2J4R0S6 |
Locus tag | M2890_RS26950 | Protein ID | WP_004181778.1 |
Coordinates | 148697..148981 (+) | Length | 95 a.a. |
Antitoxin (Protein)
Gene name | stbD | Uniprot ID | A0A2J4R0U8 |
Locus tag | M2890_RS26945 | Protein ID | WP_004181777.1 |
Coordinates | 148459..148707 (+) | Length | 83 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
M2890_RS26925 (M2890_26925) | 143668..144489 | - | 822 | WP_004181772.1 | hypothetical protein | - |
M2890_RS26930 (M2890_26930) | 144551..144904 | - | 354 | WP_004181774.1 | hypothetical protein | - |
M2890_RS26935 (M2890_26935) | 145049..146035 | - | 987 | WP_025368599.1 | hypothetical protein | - |
M2890_RS26940 (M2890_26940) | 146369..148168 | - | 1800 | WP_004181776.1 | ATP-dependent helicase | - |
M2890_RS26945 (M2890_26945) | 148459..148707 | + | 249 | WP_004181777.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
M2890_RS26950 (M2890_26950) | 148697..148981 | + | 285 | WP_004181778.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
M2890_RS26955 (M2890_26955) | 148998..149099 | - | 102 | Protein_163 | IS200/IS605 family transposase | - |
M2890_RS26960 (M2890_26960) | 149135..150361 | + | 1227 | WP_040209639.1 | RNA-guided endonuclease TnpB family protein | - |
M2890_RS26965 (M2890_26965) | 150632..150856 | - | 225 | Protein_165 | transposase | - |
M2890_RS26970 (M2890_26970) | 150935..151363 | - | 429 | WP_077257669.1 | IS200/IS605 family transposase | - |
M2890_RS26975 (M2890_26975) | 151399..152586 | + | 1188 | WP_040209642.1 | RNA-guided endonuclease TnpB family protein | - |
M2890_RS26980 (M2890_26980) | 152631..153002 | - | 372 | WP_040209644.1 | hypothetical protein | - |
M2890_RS26985 (M2890_26985) | 152999..153343 | - | 345 | WP_223811496.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Non-Mobilizable plasmid | mph(A) / mph(E) / msr(E) / armA / sul1 / qacE / aadA2 / dfrA12 | - | 1..222331 | 222331 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 95 a.a. Molecular weight: 10970.69 Da Isoelectric Point: 10.6516
>T254387 WP_004181778.1 NZ_CP102884:148697-148981 [Klebsiella pneumoniae]
MTYKLAFNESALKEWKKLGHTIREQFKKKLAERLLNPRVPASQLHGRKDQYKIKLRGAGYRLVYSVNDDVVTVTVIGVGK
RENDDIYNLTKHRN
MTYKLAFNESALKEWKKLGHTIREQFKKKLAERLLNPRVPASQLHGRKDQYKIKLRGAGYRLVYSVNDDVVTVTVIGVGK
RENDDIYNLTKHRN
Download Length: 285 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A2J4R0S6 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A2J4R0U8 |