Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | relBE/ParE-RelB |
| Location | 46446..46972 | Replicon | plasmid pKH2-1 |
| Accession | NZ_CP102884 | ||
| Organism | Klebsiella pneumoniae strain KH2 | ||
Toxin (Protein)
| Gene name | relE | Uniprot ID | S1EXL1 |
| Locus tag | M2890_RS26400 | Protein ID | WP_000323025.1 |
| Coordinates | 46685..46972 (+) | Length | 96 a.a. |
Antitoxin (Protein)
| Gene name | relB | Uniprot ID | S1F6D3 |
| Locus tag | M2890_RS26395 | Protein ID | WP_000534858.1 |
| Coordinates | 46446..46685 (+) | Length | 80 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| M2890_RS26375 (M2890_26375) | 42774..44012 | + | 1239 | WP_003030308.1 | IS110 family transposase | - |
| M2890_RS26380 (M2890_26380) | 44488..45060 | + | 573 | WP_001515348.1 | cytochrome b/b6 domain-containing protein | - |
| M2890_RS26385 (M2890_26385) | 45260..46183 | + | 924 | WP_020277922.1 | cation diffusion facilitator family transporter | - |
| M2890_RS26390 (M2890_26390) | 46317..46421 | - | 105 | Protein_50 | hypothetical protein | - |
| M2890_RS26395 (M2890_26395) | 46446..46685 | + | 240 | WP_000534858.1 | type II toxin-antitoxin system antitoxin RelB | Antitoxin |
| M2890_RS26400 (M2890_26400) | 46685..46972 | + | 288 | WP_000323025.1 | type II toxin-antitoxin system mRNA interferase RelE | Toxin |
| M2890_RS26405 (M2890_26405) | 47044..47202 | + | 159 | WP_004181898.1 | type I toxin-antitoxin system Hok family toxin | - |
| M2890_RS26410 (M2890_26410) | 47805..48056 | + | 252 | WP_258323940.1 | hypothetical protein | - |
| M2890_RS26415 (M2890_26415) | 48093..48797 | + | 705 | WP_169514062.1 | IS6-like element IS26 family transposase | - |
| M2890_RS26420 (M2890_26420) | 48846..48971 | - | 126 | Protein_56 | recombinase family protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Non-Mobilizable plasmid | mph(A) / mph(E) / msr(E) / armA / sul1 / qacE / aadA2 / dfrA12 | - | 1..222331 | 222331 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 96 a.a. Molecular weight: 11225.22 Da Isoelectric Point: 10.1967
>T254385 WP_000323025.1 NZ_CP102884:46685-46972 [Klebsiella pneumoniae]
MAYFLDFDERALKEWRKLGSTVREQLKKKLVEVLESPRIEANKLRGMPDCYKIKLRSSGYRLVYQVIDEKVVVFVISVGK
RERSEVYSEAVKRIL
MAYFLDFDERALKEWRKLGSTVREQLKKKLVEVLESPRIEANKLRGMPDCYKIKLRSSGYRLVYQVIDEKVVVFVISVGK
RERSEVYSEAVKRIL
Download Length: 288 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|