Detailed information of TA system
Overview
TA module
Type | II | Classification (family/domain) | vapBC/LOTUS_5_Limkain_b1(toxin) |
Location | 5242437..5243062 | Replicon | chromosome |
Accession | NZ_CP102883 | ||
Organism | Klebsiella pneumoniae strain KH2 |
Toxin (Protein)
Gene name | vapC | Uniprot ID | A0A483GDF6 |
Locus tag | M2890_RS25775 | Protein ID | WP_004187928.1 |
Coordinates | 5242437..5242820 (-) | Length | 128 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | J2DFR0 |
Locus tag | M2890_RS25780 | Protein ID | WP_004150355.1 |
Coordinates | 5242820..5243062 (-) | Length | 81 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
M2890_RS25760 (5239803) | 5239803..5240705 | + | 903 | WP_002882822.1 | formate dehydrogenase subunit beta | - |
M2890_RS25765 (5240702) | 5240702..5241337 | + | 636 | WP_002882818.1 | formate dehydrogenase cytochrome b556 subunit | - |
M2890_RS25770 (5241334) | 5241334..5242263 | + | 930 | WP_004150358.1 | formate dehydrogenase accessory protein FdhE | - |
M2890_RS25775 (5242437) | 5242437..5242820 | - | 384 | WP_004187928.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
M2890_RS25780 (5242820) | 5242820..5243062 | - | 243 | WP_004150355.1 | CopG family transcriptional regulator | Antitoxin |
M2890_RS25785 (5243256) | 5243256..5244173 | + | 918 | WP_032437488.1 | alpha/beta hydrolase | - |
M2890_RS25790 (5244187) | 5244187..5245128 | - | 942 | WP_004178031.1 | fatty acid biosynthesis protein FabY | - |
M2890_RS25795 (5245173) | 5245173..5245610 | - | 438 | WP_002882809.1 | D-aminoacyl-tRNA deacylase | - |
M2890_RS25800 (5245607) | 5245607..5246467 | - | 861 | WP_004146232.1 | virulence factor BrkB family protein | - |
M2890_RS25805 (5246461) | 5246461..5247060 | - | 600 | WP_004151865.1 | glucose-1-phosphatase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 128 a.a. Molecular weight: 14407.64 Da Isoelectric Point: 7.3178
>T254383 WP_004187928.1 NZ_CP102883:c5242820-5242437 [Klebsiella pneumoniae]
MTSGSALFDTNILIDLFSGRREAKQALEAWPPQNAISLITWMEVMVGAKKYHQEQRTRMALSTFNIINISQDIAERSVAL
RQEYKLKLPDAIILATAQLHRLELITRNTKDFTGIPGVVTPYEIHPE
MTSGSALFDTNILIDLFSGRREAKQALEAWPPQNAISLITWMEVMVGAKKYHQEQRTRMALSTFNIINISQDIAERSVAL
RQEYKLKLPDAIILATAQLHRLELITRNTKDFTGIPGVVTPYEIHPE
Download Length: 384 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A483GDF6 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0H3GGU9 |