Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) vagCD/VapC-VagC
Location 48352..48995 Replicon plasmid pKH1-2
Accession NZ_CP102879
Organism Klebsiella pneumoniae strain KH1

Toxin (Protein)


Gene name vagD Uniprot ID D8L2J9
Locus tag NWT87_RS27605 Protein ID WP_001044770.1
Coordinates 48579..48995 (+) Length 139 a.a.

Antitoxin (Protein)


Gene name vagC Uniprot ID D5KTK7
Locus tag NWT87_RS27600 Protein ID WP_001261282.1
Coordinates 48352..48582 (+) Length 77 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NWT87_RS27560 (NWT87_27560) 43554..43823 + 270 WP_000339857.1 hypothetical protein -
NWT87_RS27565 (NWT87_27565) 44000..44866 - 867 WP_004118283.1 replication initiation protein -
NWT87_RS27570 (NWT87_27570) 45396..45500 + 105 WP_032409716.1 hypothetical protein -
NWT87_RS27575 (NWT87_27575) 45629..45886 + 258 WP_000764642.1 hypothetical protein -
NWT87_RS27580 (NWT87_27580) 45944..46720 - 777 WP_020956881.1 tyrosine-type recombinase/integrase -
NWT87_RS27585 (NWT87_27585) 46732..47418 - 687 WP_020956882.1 hypothetical protein -
NWT87_RS27590 (NWT87_27590) 47482..47775 - 294 WP_020956883.1 hypothetical protein -
NWT87_RS27595 (NWT87_27595) 47934..48395 - 462 WP_074193041.1 hypothetical protein -
NWT87_RS27600 (NWT87_27600) 48352..48582 + 231 WP_001261282.1 type II toxin-antitoxin system VapB family antitoxin Antitoxin
NWT87_RS27605 (NWT87_27605) 48579..48995 + 417 WP_001044770.1 type II toxin-antitoxin system VapC family toxin Toxin
NWT87_RS27610 (NWT87_27610) 49069..50631 + 1563 WP_004206609.1 AAA family ATPase -
NWT87_RS27615 (NWT87_27615) 50616..51638 + 1023 WP_000361404.1 helicase UvrD -
NWT87_RS27620 (NWT87_27620) 52182..53090 + 909 WP_032411229.1 HNH endonuclease -
NWT87_RS27625 (NWT87_27625) 53276..53626 - 351 WP_004187110.1 DUF305 domain-containing protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Mobilizable plasmid aac(6')-Ib-cr / ARR-3 / dfrA27 / aadA16 / qacE / sul1 / qnrB52 / blaCTX-M-27 / floR - 1..101383 101383


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

PIN domain

(5-129)

Antitoxin

SpoVT-AbrB domain

(7-47)


Sequences

Toxin        


Download         Length: 139 a.a.        Molecular weight: 15106.52 Da        Isoelectric Point: 7.1084

>T254367 WP_001044770.1 NZ_CP102879:48579-48995 [Klebsiella pneumoniae]
VNKTYMLDTCICSFIMREQPEAVLKRLEQAVLRGQRIVVSAITYSEMRFGATGPKASPRHVELVDAFCARLDAILPWDRA
AVDATTEIKVALRMAGTPIGPNDTAIAGHAIAAGAVLVTNNTREFERVPGLVLEDWVR

Download         Length: 417 bp

Antitoxin


Download         Length: 77 a.a.        Molecular weight: 8756.83 Da        Isoelectric Point: 4.4692

>AT254367 WP_001261282.1 NZ_CP102879:48352-48582 [Klebsiella pneumoniae]
MRTVSIFKNGNNRAIRLPRDLDFEGVSELEIVREGDSIILRPVRPTWGSFAQFEKADPDFMAEREDVVSDEGRFNL

Download         Length: 231 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A0H3GYM2

Antitoxin

Source ID Structure
AlphaFold DB A0A0H3GZG3

References