Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vagCD/VapC-VagC |
| Location | 48352..48995 | Replicon | plasmid pKH1-2 |
| Accession | NZ_CP102879 | ||
| Organism | Klebsiella pneumoniae strain KH1 | ||
Toxin (Protein)
| Gene name | vagD | Uniprot ID | D8L2J9 |
| Locus tag | NWT87_RS27605 | Protein ID | WP_001044770.1 |
| Coordinates | 48579..48995 (+) | Length | 139 a.a. |
Antitoxin (Protein)
| Gene name | vagC | Uniprot ID | D5KTK7 |
| Locus tag | NWT87_RS27600 | Protein ID | WP_001261282.1 |
| Coordinates | 48352..48582 (+) | Length | 77 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NWT87_RS27560 (NWT87_27560) | 43554..43823 | + | 270 | WP_000339857.1 | hypothetical protein | - |
| NWT87_RS27565 (NWT87_27565) | 44000..44866 | - | 867 | WP_004118283.1 | replication initiation protein | - |
| NWT87_RS27570 (NWT87_27570) | 45396..45500 | + | 105 | WP_032409716.1 | hypothetical protein | - |
| NWT87_RS27575 (NWT87_27575) | 45629..45886 | + | 258 | WP_000764642.1 | hypothetical protein | - |
| NWT87_RS27580 (NWT87_27580) | 45944..46720 | - | 777 | WP_020956881.1 | tyrosine-type recombinase/integrase | - |
| NWT87_RS27585 (NWT87_27585) | 46732..47418 | - | 687 | WP_020956882.1 | hypothetical protein | - |
| NWT87_RS27590 (NWT87_27590) | 47482..47775 | - | 294 | WP_020956883.1 | hypothetical protein | - |
| NWT87_RS27595 (NWT87_27595) | 47934..48395 | - | 462 | WP_074193041.1 | hypothetical protein | - |
| NWT87_RS27600 (NWT87_27600) | 48352..48582 | + | 231 | WP_001261282.1 | type II toxin-antitoxin system VapB family antitoxin | Antitoxin |
| NWT87_RS27605 (NWT87_27605) | 48579..48995 | + | 417 | WP_001044770.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
| NWT87_RS27610 (NWT87_27610) | 49069..50631 | + | 1563 | WP_004206609.1 | AAA family ATPase | - |
| NWT87_RS27615 (NWT87_27615) | 50616..51638 | + | 1023 | WP_000361404.1 | helicase UvrD | - |
| NWT87_RS27620 (NWT87_27620) | 52182..53090 | + | 909 | WP_032411229.1 | HNH endonuclease | - |
| NWT87_RS27625 (NWT87_27625) | 53276..53626 | - | 351 | WP_004187110.1 | DUF305 domain-containing protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Mobilizable plasmid | aac(6')-Ib-cr / ARR-3 / dfrA27 / aadA16 / qacE / sul1 / qnrB52 / blaCTX-M-27 / floR | - | 1..101383 | 101383 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 139 a.a. Molecular weight: 15106.52 Da Isoelectric Point: 7.1084
>T254367 WP_001044770.1 NZ_CP102879:48579-48995 [Klebsiella pneumoniae]
VNKTYMLDTCICSFIMREQPEAVLKRLEQAVLRGQRIVVSAITYSEMRFGATGPKASPRHVELVDAFCARLDAILPWDRA
AVDATTEIKVALRMAGTPIGPNDTAIAGHAIAAGAVLVTNNTREFERVPGLVLEDWVR
VNKTYMLDTCICSFIMREQPEAVLKRLEQAVLRGQRIVVSAITYSEMRFGATGPKASPRHVELVDAFCARLDAILPWDRA
AVDATTEIKVALRMAGTPIGPNDTAIAGHAIAAGAVLVTNNTREFERVPGLVLEDWVR
Download Length: 417 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0H3GYM2 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0H3GZG3 |