Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | ataRT/ElaA-DUF1778 |
Location | 89747..90498 | Replicon | plasmid pKH1-1 |
Accession | NZ_CP102878 | ||
Organism | Klebsiella pneumoniae strain KH1 |
Toxin (Protein)
Gene name | ataT | Uniprot ID | H6U1U8 |
Locus tag | NWT87_RS26625 | Protein ID | WP_014386536.1 |
Coordinates | 89747..90229 (-) | Length | 161 a.a. |
Antitoxin (Protein)
Gene name | ataR | Uniprot ID | A0A071LPN3 |
Locus tag | NWT87_RS26630 | Protein ID | WP_004902250.1 |
Coordinates | 90220..90498 (-) | Length | 93 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NWT87_RS26605 (NWT87_26605) | 86146..86793 | - | 648 | WP_014386537.1 | EcsC family protein | - |
NWT87_RS26610 (NWT87_26610) | 86820..87575 | - | 756 | WP_004902235.1 | DUF2971 domain-containing protein | - |
NWT87_RS26615 (NWT87_26615) | 87676..88068 | - | 393 | WP_032442757.1 | hypothetical protein | - |
NWT87_RS26620 (NWT87_26620) | 88173..88712 | - | 540 | WP_004902239.1 | hypothetical protein | - |
NWT87_RS26625 (NWT87_26625) | 89747..90229 | - | 483 | WP_014386536.1 | GNAT family N-acetyltransferase | Toxin |
NWT87_RS26630 (NWT87_26630) | 90220..90498 | - | 279 | WP_004902250.1 | DUF1778 domain-containing protein | Antitoxin |
NWT87_RS26635 (NWT87_26635) | 90617..90829 | - | 213 | WP_004902255.1 | hypothetical protein | - |
NWT87_RS26640 (NWT87_26640) | 90937..91278 | - | 342 | WP_004902257.1 | hypothetical protein | - |
NWT87_RS26645 (NWT87_26645) | 92108..92566 | - | 459 | WP_014386535.1 | hypothetical protein | - |
NWT87_RS26650 (NWT87_26650) | 93219..93674 | - | 456 | WP_001166628.1 | Hg(II)-responsive transcriptional regulator | - |
NWT87_RS26655 (NWT87_26655) | 93746..94111 | + | 366 | WP_001294656.1 | mercuric ion transporter MerT | - |
NWT87_RS26660 (NWT87_26660) | 94127..94402 | + | 276 | WP_000732275.1 | mercury resistance system periplasmic binding protein MerP | - |
NWT87_RS26665 (NWT87_26665) | 94430..94855 | + | 426 | WP_000522996.1 | organomercurial transporter MerC | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Non-Mobilizable plasmid | mph(A) / mph(E) / msr(E) / armA / sul1 / qacE / aadA2 / dfrA12 | - | 1..222330 | 222330 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 161 a.a. Molecular weight: 17662.45 Da Isoelectric Point: 8.9130
>T254365 WP_014386536.1 NZ_CP102878:c90229-89747 [Klebsiella pneumoniae]
MGMRAPESLTAEHNIAEFCCQEPALNEWLKKKALRNHSTGISRVYVVCAENTNRVIGYYCLSSGSVHRNTVPGAYRRNAP
DVIPVIVLGRLAIDQAWAGNGLGAALLKDAIYRTQNIAFQVGVRALAVHALNEEVKCFYTRFGFEPSIVNTLTLLFPIKV
MGMRAPESLTAEHNIAEFCCQEPALNEWLKKKALRNHSTGISRVYVVCAENTNRVIGYYCLSSGSVHRNTVPGAYRRNAP
DVIPVIVLGRLAIDQAWAGNGLGAALLKDAIYRTQNIAFQVGVRALAVHALNEEVKCFYTRFGFEPSIVNTLTLLFPIKV
Download Length: 483 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A2A5MBI1 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A071LPN3 |