Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | relBE/ParE-RelB |
Location | 46446..46972 | Replicon | plasmid pKH1-1 |
Accession | NZ_CP102878 | ||
Organism | Klebsiella pneumoniae strain KH1 |
Toxin (Protein)
Gene name | relE | Uniprot ID | S1EXL1 |
Locus tag | NWT87_RS26400 | Protein ID | WP_000323025.1 |
Coordinates | 46685..46972 (+) | Length | 96 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | S1F6D3 |
Locus tag | NWT87_RS26395 | Protein ID | WP_000534858.1 |
Coordinates | 46446..46685 (+) | Length | 80 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NWT87_RS26375 (NWT87_26375) | 42774..44012 | + | 1239 | WP_003030308.1 | IS110 family transposase | - |
NWT87_RS26380 (NWT87_26380) | 44488..45060 | + | 573 | WP_001515348.1 | cytochrome b/b6 domain-containing protein | - |
NWT87_RS26385 (NWT87_26385) | 45260..46183 | + | 924 | WP_020277922.1 | cation diffusion facilitator family transporter | - |
NWT87_RS26390 (NWT87_26390) | 46317..46421 | - | 105 | Protein_50 | hypothetical protein | - |
NWT87_RS26395 (NWT87_26395) | 46446..46685 | + | 240 | WP_000534858.1 | type II toxin-antitoxin system antitoxin RelB | Antitoxin |
NWT87_RS26400 (NWT87_26400) | 46685..46972 | + | 288 | WP_000323025.1 | type II toxin-antitoxin system mRNA interferase RelE | Toxin |
NWT87_RS26405 (NWT87_26405) | 47044..47202 | + | 159 | WP_004181898.1 | type I toxin-antitoxin system Hok family toxin | - |
NWT87_RS26410 (NWT87_26410) | 47805..48056 | + | 252 | WP_258323940.1 | hypothetical protein | - |
NWT87_RS26415 (NWT87_26415) | 48093..48797 | + | 705 | WP_001067858.1 | IS6-like element IS26 family transposase | - |
NWT87_RS26420 (NWT87_26420) | 48846..48971 | - | 126 | Protein_56 | recombinase family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Non-Mobilizable plasmid | mph(A) / mph(E) / msr(E) / armA / sul1 / qacE / aadA2 / dfrA12 | - | 1..222330 | 222330 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 96 a.a. Molecular weight: 11225.22 Da Isoelectric Point: 10.1967
>T254364 WP_000323025.1 NZ_CP102878:46685-46972 [Klebsiella pneumoniae]
MAYFLDFDERALKEWRKLGSTVREQLKKKLVEVLESPRIEANKLRGMPDCYKIKLRSSGYRLVYQVIDEKVVVFVISVGK
RERSEVYSEAVKRIL
MAYFLDFDERALKEWRKLGSTVREQLKKKLVEVLESPRIEANKLRGMPDCYKIKLRSSGYRLVYQVIDEKVVVFVISVGK
RERSEVYSEAVKRIL
Download Length: 288 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|